Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8289
Gene name
Locationscaffold_90:943..3889
Strand-
Gene length (bp)2946
Transcript length (bp)2835
Coding sequence length (bp)2832
Protein length (aa) 944

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02386 TrkH Cation transport protein 3.7E-139 430 819

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P28584|TRK2_YEAST Low-affinity potassium transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRK2 PE=1 SV=1 6 815 5.0E-169
sp|P12685|TRK1_YEAST High-affinity potassium transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRK1 PE=1 SV=1 432 815 6.0E-134
sp|P28569|TRK1_SACUV High-affinity potassium transport protein OS=Saccharomyces uvarum GN=TRK1 PE=3 SV=1 432 815 2.0E-132
sp|P47946|TRK1_SCHPO Potassium transport protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trk1 PE=3 SV=2 380 823 2.0E-127
sp|Q10065|TRK2_SCHPO Potassium transport protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trk2 PE=2 SV=1 403 823 4.0E-116
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P28584|TRK2_YEAST Low-affinity potassium transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRK2 PE=1 SV=1 6 815 5.0E-169
sp|P12685|TRK1_YEAST High-affinity potassium transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRK1 PE=1 SV=1 432 815 6.0E-134
sp|P28569|TRK1_SACUV High-affinity potassium transport protein OS=Saccharomyces uvarum GN=TRK1 PE=3 SV=1 432 815 2.0E-132
sp|P47946|TRK1_SCHPO Potassium transport protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trk1 PE=3 SV=2 380 823 2.0E-127
sp|Q10065|TRK2_SCHPO Potassium transport protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trk2 PE=2 SV=1 403 823 4.0E-116
sp|Q54DA4|Y2412_DICDI Putative potassium transport protein DDB_G0292412 OS=Dictyostelium discoideum GN=DDB_G0292412 PE=2 SV=1 448 810 6.0E-39
sp|P47946|TRK1_SCHPO Potassium transport protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trk1 PE=3 SV=2 25 162 4.0E-24
sp|P12685|TRK1_YEAST High-affinity potassium transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRK1 PE=1 SV=1 29 242 3.0E-22
sp|Q84TI7|HKT1_ARATH Sodium transporter HKT1 OS=Arabidopsis thaliana GN=HKT1 PE=1 SV=1 451 816 1.0E-21
sp|P28569|TRK1_SACUV High-affinity potassium transport protein OS=Saccharomyces uvarum GN=TRK1 PE=3 SV=1 28 156 8.0E-21
sp|Q10065|TRK2_SCHPO Potassium transport protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trk2 PE=2 SV=1 24 128 2.0E-15
sp|Q0D9S3|HKT1_ORYSJ Cation transporter HKT1 OS=Oryza sativa subsp. japonica GN=HKT1 PE=1 SV=1 505 805 4.0E-15
sp|A2YGP9|HKT1_ORYSI Cation transporter HKT1 OS=Oryza sativa subsp. indica GN=HKT1 PE=1 SV=2 505 805 4.0E-15
sp|Q6H501|HKT6_ORYSJ Probable cation transporter HKT6 OS=Oryza sativa subsp. japonica GN=HKT6 PE=2 SV=1 451 800 2.0E-14
sp|Q7XPF8|HKT4_ORYSJ Cation transporter HKT4 OS=Oryza sativa subsp. japonica GN=HKT4 PE=1 SV=2 499 800 4.0E-14
sp|Q8L481|HKT3_ORYSJ Probable cation transporter HKT3 OS=Oryza sativa subsp. japonica GN=HKT3 PE=2 SV=1 459 770 2.0E-13
sp|Q93XI5|HKT2_ORYSI Cation transporter HKT2 OS=Oryza sativa subsp. indica GN=HKT2 PE=1 SV=1 483 805 5.0E-13
sp|Q8L4K5|HKT9_ORYSJ Probable cation transporter HKT9 OS=Oryza sativa subsp. japonica GN=HKT9 PE=2 SV=1 460 798 7.0E-13
sp|O31658|KTRD_BACSU Ktr system potassium uptake protein D OS=Bacillus subtilis (strain 168) GN=ktrD PE=3 SV=1 511 798 2.0E-10
sp|Q7XPF7|HKT7_ORYSJ Probable cation transporter HKT7 OS=Oryza sativa subsp. japonica GN=HKT7 PE=2 SV=2 508 800 8.0E-10
sp|O87953|KTRB_VIBAL Ktr system potassium uptake protein B OS=Vibrio alginolyticus GN=ktrB PE=1 SV=1 509 798 7.0E-09
sp|A2WNZ9|HKT8_ORYSI Cation transporter HKT8 OS=Oryza sativa subsp. indica GN=HKT8 PE=2 SV=2 502 800 7.0E-08
sp|Q0JNB6|HKT8_ORYSJ Cation transporter HKT8 OS=Oryza sativa subsp. japonica GN=HKT8 PE=3 SV=1 502 800 1.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0006812 cation transport Yes
GO:0008324 cation transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0006811 ion transport No
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0022857 transmembrane transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.5

Transmembrane Domains

Domain # Start End Length
1 29 51 22
2 87 109 22
3 469 491 22
4 541 563 22
5 601 623 22
6 661 683 22
7 723 742 19
8 752 774 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8289
MIETARDYVWTQLKAVKPAFVSKKPHFNFITVHYFWIISATIIASIAIYASGKGRLSYIDALMFGSGANTQAGLN
PVDLNTLNGFQQAMIYLFSMVSNPVTLNACVVFLRLYWFEKRFQSWVREIRLRRPTLTKTRSKSVADVEMVAPQQ
QQGVNGRHITIVPQNGRPQRITNDGILLDGDRDVSPHSSDRVKSEGSDSTTVTDDKQNEGDGAHTDAARPLGGST
NDDDDNVGPAESPGSPRAGQAGHLSISFANTVKRSDGMGEDALKTPHHRSNAEHIAILERQRNQDNEVLRIPGPR
DAERGLGPRRLQDDDPQDEDENALTKTRTADSQANQAAPDLRHIRGRQPTITIAEPTRRAERVKDNARTISGTLE
SLRLRKPLQPRIGRTAHREGSGDDRRPSRSRSAAGLRRLSVIRQALSLSREQEEMPYLSYTPTLARNSNFVGLTL
DQREELGGIEYRSLRTLAVILLLYFWGFQLLILTCLWPYILHNAFYGKAVESAHVNRTWWAFFTSNAAFMDVGFT
LTPDSMISFQTSEFVLMIMWFFIIIGNTGFPVMLRFLIWVAAKLTPRGSGLWEELRFLLDHPRRCFTLMFPSGPT
WWLFWILVILNAIDLLFFIVLDLGGEPIDKLPLKNRVVIGFFQAASTRTAGFSAVNLSELHPAMPVLYMIMMYIS
VFPIAISIRRTNVYEERSLGVYHEHEVDDDADSSALSYVGSHLRRQLSFDLWYVFLGFFILAITEGGKIQAHKFD
LFAVLFEVVSAYGTVGLSLGVAGVNASLSSQFSVIGKLVIIAMQIRGRHRGLPYGLDRAVLLPSESRFRKEAEAA
DAEAAHVNVSGASTGLQRQRTNPGVRRSMSRERDRANSNLISQFLHPGPVVHRDTALPHQRPRSVDSYSPSLHSP
SVFATSLGPRTQTEPVAETGGDELTTPSSASSHHKPLRSGTSAF
Coding >Ophio5|8289
ATGATTGAAACGGCGCGGGATTATGTGTGGACCCAGCTCAAGGCTGTCAAGCCTGCCTTTGTCTCCAAGAAGCCG
CATTTCAACTTCATCACGGTCCACTATTTCTGGATTATCAGCGCAACCATTATAGCATCCATTGCCATCTATGCT
TCGGGAAAAGGCAGGCTGTCATATATCGATGCCTTGATGTTCGGCAGTGGCGCCAACACGCAAGCCGGCCTGAAC
CCCGTCGATCTCAACACGCTCAATGGATTTCAGCAGGCCATGATCTACCTGTTTTCCATGGTTTCCAACCCCGTA
ACCCTCAACGCCTGCGTCGTCTTTCTTCGCCTCTACTGGTTCGAGAAGCGCTTCCAGAGCTGGGTCAGAGAAATC
CGCTTGCGACGTCCCACCCTGACCAAGACCAGATCAAAGTCGGTCGCCGACGTGGAGATGGTCGCGCCCCAGCAA
CAACAGGGCGTCAATGGGCGTCACATCACAATCGTGCCGCAAAACGGCCGGCCACAGAGGATCACTAACGACGGC
ATCCTGTTGGACGGTGACAGGGACGTATCGCCCCACTCCTCGGACAGAGTCAAAAGCGAGGGCAGCGACTCGACT
ACCGTCACGGACGACAAGCAAAACGAGGGGGACGGAGCCCATACCGATGCGGCTCGGCCCCTCGGCGGCAGCACA
AACGACGACGACGACAATGTCGGCCCCGCAGAGTCCCCCGGGAGTCCTAGGGCTGGTCAGGCCGGCCACCTGTCC
ATCTCATTTGCCAACACGGTCAAGAGAAGCGACGGCATGGGTGAAGATGCCCTCAAGACACCGCACCATCGTTCC
AACGCCGAGCACATTGCCATTCTGGAGCGGCAGCGGAACCAAGACAACGAGGTGCTGCGCATTCCGGGGCCTCGC
GATGCGGAGAGGGGTCTGGGCCCTAGAAGGCTTCAAGACGACGATCCGCAGGACGAGGACGAAAATGCGCTCACC
AAGACGAGGACGGCGGACTCGCAGGCCAACCAGGCAGCACCCGACCTGAGGCATATCCGTGGACGCCAGCCAACC
ATCACCATTGCAGAGCCAACCCGTCGGGCGGAGAGGGTCAAAGACAATGCTCGGACGATAAGCGGCACCTTGGAG
TCGCTTCGCCTTCGAAAGCCCCTCCAGCCGCGCATCGGCCGGACAGCTCATCGTGAGGGCAGCGGCGACGACCGC
AGGCCCTCTCGCTCCAGGAGCGCAGCCGGCTTGCGCAGGCTAAGCGTCATTCGGCAAGCCCTGTCCTTGTCGAGG
GAGCAGGAGGAGATGCCCTACCTCTCGTATACGCCGACGCTCGCCCGCAACTCCAACTTTGTCGGCCTCACTCTC
GACCAACGCGAGGAGCTCGGCGGCATCGAGTACCGCTCACTCAGGACGCTCGCCGTCATCCTCTTGCTCTACTTT
TGGGGCTTCCAGCTTCTCATCCTTACCTGTCTTTGGCCCTATATCCTGCACAACGCCTTTTACGGCAAGGCTGTC
GAGAGCGCTCACGTCAACAGGACCTGGTGGGCTTTCTTCACGTCCAATGCCGCCTTCATGGACGTCGGCTTCACC
CTCACGCCTGATAGCATGATCTCCTTCCAGACGTCCGAGTTCGTCCTGATGATCATGTGGTTCTTCATCATCATC
GGGAACACGGGCTTCCCAGTCATGCTTCGCTTCCTCATCTGGGTCGCCGCCAAGCTCACCCCGAGGGGGTCCGGC
CTGTGGGAGGAGTTGAGATTCCTGCTTGACCACCCGCGTCGGTGCTTCACGCTCATGTTTCCGTCCGGTCCTACC
TGGTGGCTGTTTTGGATCCTTGTCATCCTGAACGCCATCGATCTTCTCTTCTTCATCGTTCTCGACCTCGGCGGA
GAACCCATTGACAAGCTTCCGCTCAAGAACCGTGTCGTGATCGGTTTCTTCCAGGCAGCCTCGACGAGAACGGCG
GGCTTCTCGGCCGTCAACCTATCCGAACTGCATCCAGCGATGCCGGTGCTGTACATGATCATGATGTACATTTCC
GTCTTTCCCATCGCAATCTCGATTCGACGAACAAACGTCTACGAAGAGAGGTCGCTGGGCGTCTATCACGAACAT
GAAGTCGACGACGATGCCGACTCGAGCGCCCTGTCATACGTGGGAAGCCACTTGCGGCGCCAGCTCTCGTTCGAT
CTGTGGTATGTCTTCCTCGGCTTCTTCATCCTGGCCATCACCGAGGGGGGCAAGATTCAAGCGCACAAGTTCGAC
CTGTTCGCCGTGCTTTTCGAGGTGGTCAGTGCCTACGGCACTGTCGGCCTGAGCTTGGGAGTAGCCGGCGTCAAC
GCGTCTCTAAGCTCCCAATTCTCCGTCATCGGCAAGCTAGTCATCATCGCCATGCAGATCCGGGGCCGGCATCGC
GGGCTCCCGTACGGCCTCGACCGGGCCGTCCTGCTACCCAGCGAATCCCGGTTCCGAAAGGAGGCGGAAGCGGCC
GACGCCGAAGCCGCCCACGTCAACGTTTCCGGCGCCTCGACGGGTCTGCAGCGGCAGAGGACCAACCCAGGTGTC
AGGCGCAGCATGAGCCGCGAGCGGGACCGGGCTAACAGCAACCTGATATCCCAATTCCTACATCCGGGCCCTGTA
GTGCATCGCGATACAGCGCTGCCACACCAGAGGCCCCGATCTGTCGACTCGTACTCGCCCTCTCTCCATTCGCCC
TCGGTGTTCGCCACATCGCTGGGACCGAGGACGCAGACGGAACCCGTAGCCGAAACGGGTGGGGACGAGTTGACG
ACACCCAGCTCGGCTTCATCGCACCACAAGCCGTTGAGGTCAGGGACGTCGGCGTTT
Transcript >Ophio5|8289
ATGATTGAAACGGCGCGGGATTATGTGTGGACCCAGCTCAAGGCTGTCAAGCCTGCCTTTGTCTCCAAGAAGCCG
CATTTCAACTTCATCACGGTCCACTATTTCTGGATTATCAGCGCAACCATTATAGCATCCATTGCCATCTATGCT
TCGGGAAAAGGCAGGCTGTCATATATCGATGCCTTGATGTTCGGCAGTGGCGCCAACACGCAAGCCGGCCTGAAC
CCCGTCGATCTCAACACGCTCAATGGATTTCAGCAGGCCATGATCTACCTGTTTTCCATGGTTTCCAACCCCGTA
ACCCTCAACGCCTGCGTCGTCTTTCTTCGCCTCTACTGGTTCGAGAAGCGCTTCCAGAGCTGGGTCAGAGAAATC
CGCTTGCGACGTCCCACCCTGACCAAGACCAGATCAAAGTCGGTCGCCGACGTGGAGATGGTCGCGCCCCAGCAA
CAACAGGGCGTCAATGGGCGTCACATCACAATCGTGCCGCAAAACGGCCGGCCACAGAGGATCACTAACGACGGC
ATCCTGTTGGACGGTGACAGGGACGTATCGCCCCACTCCTCGGACAGAGTCAAAAGCGAGGGCAGCGACTCGACT
ACCGTCACGGACGACAAGCAAAACGAGGGGGACGGAGCCCATACCGATGCGGCTCGGCCCCTCGGCGGCAGCACA
AACGACGACGACGACAATGTCGGCCCCGCAGAGTCCCCCGGGAGTCCTAGGGCTGGTCAGGCCGGCCACCTGTCC
ATCTCATTTGCCAACACGGTCAAGAGAAGCGACGGCATGGGTGAAGATGCCCTCAAGACACCGCACCATCGTTCC
AACGCCGAGCACATTGCCATTCTGGAGCGGCAGCGGAACCAAGACAACGAGGTGCTGCGCATTCCGGGGCCTCGC
GATGCGGAGAGGGGTCTGGGCCCTAGAAGGCTTCAAGACGACGATCCGCAGGACGAGGACGAAAATGCGCTCACC
AAGACGAGGACGGCGGACTCGCAGGCCAACCAGGCAGCACCCGACCTGAGGCATATCCGTGGACGCCAGCCAACC
ATCACCATTGCAGAGCCAACCCGTCGGGCGGAGAGGGTCAAAGACAATGCTCGGACGATAAGCGGCACCTTGGAG
TCGCTTCGCCTTCGAAAGCCCCTCCAGCCGCGCATCGGCCGGACAGCTCATCGTGAGGGCAGCGGCGACGACCGC
AGGCCCTCTCGCTCCAGGAGCGCAGCCGGCTTGCGCAGGCTAAGCGTCATTCGGCAAGCCCTGTCCTTGTCGAGG
GAGCAGGAGGAGATGCCCTACCTCTCGTATACGCCGACGCTCGCCCGCAACTCCAACTTTGTCGGCCTCACTCTC
GACCAACGCGAGGAGCTCGGCGGCATCGAGTACCGCTCACTCAGGACGCTCGCCGTCATCCTCTTGCTCTACTTT
TGGGGCTTCCAGCTTCTCATCCTTACCTGTCTTTGGCCCTATATCCTGCACAACGCCTTTTACGGCAAGGCTGTC
GAGAGCGCTCACGTCAACAGGACCTGGTGGGCTTTCTTCACGTCCAATGCCGCCTTCATGGACGTCGGCTTCACC
CTCACGCCTGATAGCATGATCTCCTTCCAGACGTCCGAGTTCGTCCTGATGATCATGTGGTTCTTCATCATCATC
GGGAACACGGGCTTCCCAGTCATGCTTCGCTTCCTCATCTGGGTCGCCGCCAAGCTCACCCCGAGGGGGTCCGGC
CTGTGGGAGGAGTTGAGATTCCTGCTTGACCACCCGCGTCGGTGCTTCACGCTCATGTTTCCGTCCGGTCCTACC
TGGTGGCTGTTTTGGATCCTTGTCATCCTGAACGCCATCGATCTTCTCTTCTTCATCGTTCTCGACCTCGGCGGA
GAACCCATTGACAAGCTTCCGCTCAAGAACCGTGTCGTGATCGGTTTCTTCCAGGCAGCCTCGACGAGAACGGCG
GGCTTCTCGGCCGTCAACCTATCCGAACTGCATCCAGCGATGCCGGTGCTGTACATGATCATGATGTACATTTCC
GTCTTTCCCATCGCAATCTCGATTCGACGAACAAACGTCTACGAAGAGAGGTCGCTGGGCGTCTATCACGAACAT
GAAGTCGACGACGATGCCGACTCGAGCGCCCTGTCATACGTGGGAAGCCACTTGCGGCGCCAGCTCTCGTTCGAT
CTGTGGTATGTCTTCCTCGGCTTCTTCATCCTGGCCATCACCGAGGGGGGCAAGATTCAAGCGCACAAGTTCGAC
CTGTTCGCCGTGCTTTTCGAGGTGGTCAGTGCCTACGGCACTGTCGGCCTGAGCTTGGGAGTAGCCGGCGTCAAC
GCGTCTCTAAGCTCCCAATTCTCCGTCATCGGCAAGCTAGTCATCATCGCCATGCAGATCCGGGGCCGGCATCGC
GGGCTCCCGTACGGCCTCGACCGGGCCGTCCTGCTACCCAGCGAATCCCGGTTCCGAAAGGAGGCGGAAGCGGCC
GACGCCGAAGCCGCCCACGTCAACGTTTCCGGCGCCTCGACGGGTCTGCAGCGGCAGAGGACCAACCCAGGTGTC
AGGCGCAGCATGAGCCGCGAGCGGGACCGGGCTAACAGCAACCTGATATCCCAATTCCTACATCCGGGCCCTGTA
GTGCATCGCGATACAGCGCTGCCACACCAGAGGCCCCGATCTGTCGACTCGTACTCGCCCTCTCTCCATTCGCCC
TCGGTGTTCGCCACATCGCTGGGACCGAGGACGCAGACGGAACCCGTAGCCGAAACGGGTGGGGACGAGTTGACG
ACACCCAGCTCGGCTTCATCGCACCACAAGCCGTTGAGGTCAGGGACGTCGGCGTTTTAG
Gene >Ophio5|8289
ATGATTGAAACGGCGCGGGATTATGTGTGGACCCAGCTCAAGGCTGTCAAGCCTGCCTTTGTCTCCAAGAAGCCG
CATTTCAACTTCATCACGGTCCACTGTTCGTCGGCTCCCCTATAGTCCTTCAAGAGCTAACTAACCTTGGATGCC
CAGATTTCTGGATTATCAGCGCAACCATTATAGCATCCATTGCCATCTATGCTTCGGGAAAAGGCAGGCTGTCAT
ATATCGATGCCTTGATGTTCGGCAGTGGCGCCAACACGCAAGCCGGCCTGAACCCCGTCGATCTCAACACGCTCA
ATGGATTTCAGCAGGCCATGATCTACCTGTTTTCCATGGTTTCCAACCCCGTAACCCTCAACGCCTGCGTCGTCT
TTCTTCGCCTCTACTGGTTCGAGAAGCGCTTCCAGAGCTGGGTCAGAGAAATCCGCTTGCGACGTCCCACCCTGA
CCAAGACCAGATCAAAGTCGGTCGCCGACGTGGAGATGGTCGCGCCCCAGCAACAACAGGGCGTCAATGGGCGTC
ACATCACAATCGTGCCGCAAAACGGCCGGCCACAGAGGATCACTAACGACGGCATCCTGTTGGACGGTGACAGGG
ACGTATCGCCCCACTCCTCGGACAGAGTCAAAAGCGAGGGCAGCGACTCGACTACCGTCACGGACGACAAGCAAA
ACGAGGGGGACGGAGCCCATACCGATGCGGCTCGGCCCCTCGGCGGCAGCACAAACGACGACGACGACAATGTCG
GCCCCGCAGAGTCCCCCGGGAGTCCTAGGGCTGGTCAGGCCGGCCACCTGTCCATCTCATTTGCCAACACGGTCA
AGAGAAGCGACGGCATGGGTGAAGATGCCCTCAAGACACCGCACCATCGTTCCAACGCCGAGCACATTGCCATTC
TGGAGCGGCAGCGGAACCAAGACAACGAGGTGCTGCGCATTCCGGGGCCTCGCGATGCGGAGAGGGGTCTGGGCC
CTAGAAGGCTTCAAGACGACGATCCGCAGGACGAGGACGAAAATGCGCTCACCAAGACGAGGACGGCGGACTCGC
AGGCCAACCAGGCAGCACCCGACCTGAGGCATATCCGTGGACGCCAGCCAACCATCACCATTGCAGAGCCAACCC
GTCGGGCGGAGAGGGTCAAAGACAATGCTCGGACGATAAGCGGCACCTTGGAGTCGCTTCGCCTTCGAAAGCCCC
TCCAGCCGCGCATCGGCCGGACAGCTCATCGTGAGGGCAGCGGCGACGACCGCAGGCCCTCTCGCTCCAGGAGCG
CAGCCGGCTTGCGCAGGCTAAGCGTCATTCGGCAAGCCCTGTCCTTGTCGAGGGAGCAGGAGGAGATGCCCTACC
TCTCGTATACGCCGACGCTCGCCCGCAACTCCAACTTTGTCGGCCTCACTCTCGACCAACGCGAGGAGCTCGGCG
GCATCGAGTACCGCTCACTCAGGACGCTCGCCGTCATCCTCTTGCTCTACTTTTGGGGCTTCCAGCTTCTCATCC
TTACCTGTCTTTGGCCCTATATCCTGCACAACGCCTTTTACGGCAAGGCTGTCGAGAGCGCTCACGTCAACAGGA
CCTGGTGGGCTTTCTTCACGTCCAATGCCGCCTTCATGGACGTCGGCTTCACCCTCACGCCTGATAGCATGATCT
CCTTCCAGACGTCCGAGTTCGTCCTGATGATCATGTGGTTCTTCATCATCATCGGGAACACGGGCTTCCCAGTCA
TGCTTCGCTTCCTCATCTGGGTCGCCGCCAAGCTCACCCCGAGGGGGTCCGGCCTGTGGGAGGAGTTGAGATTCC
TGCTTGACCACCCGCGTCGGTGCTTCACGCTCATGTTTCCGTCCGGTCCTACCTGGTGGCTGTTTTGGATCCTTG
TCATCCTGAACGCCATCGATCTTCTCTTCTTCATCGTTCTCGACGTACGTTCTCTGCTGCCCGAACCATGGTCCT
CCGTACCGCTAACTCTTTGTCGCGCAGCTCGGCGGAGAACCCATTGACAAGCTTCCGCTCAAGAACCGTGTCGTG
ATCGGTTTCTTCCAGGCAGCCTCGACGAGAACGGCGGGCTTCTCGGCCGTCAACCTATCCGAACTGCATCCAGCG
ATGCCGGTGCTGTACATGATCATGATGTACATTTCCGTCTTTCCCATCGCAATCTCGATTCGACGAACAAACGTC
TACGAAGAGAGGTCGCTGGGCGTCTATCACGAACATGAAGTCGACGACGATGCCGACTCGAGCGCCCTGTCATAC
GTGGGAAGCCACTTGCGGCGCCAGCTCTCGTTCGATCTGTGGTATGTCTTCCTCGGCTTCTTCATCCTGGCCATC
ACCGAGGGGGGCAAGATTCAAGCGCACAAGTTCGACCTGTTCGCCGTGCTTTTCGAGGTGGTCAGTGCCTACGGC
ACTGTCGGCCTGAGCTTGGGAGTAGCCGGCGTCAACGCGTCTCTAAGCTCCCAATTCTCCGTCATCGGCAAGCTA
GTCATCATCGCCATGCAGATCCGGGGCCGGCATCGCGGGCTCCCGTACGGCCTCGACCGGGCCGTCCTGCTACCC
AGCGAATCCCGGTTCCGAAAGGAGGCGGAAGCGGCCGACGCCGAAGCCGCCCACGTCAACGTTTCCGGCGCCTCG
ACGGGTCTGCAGCGGCAGAGGACCAACCCAGGTGTCAGGCGCAGCATGAGCCGCGAGCGGGACCGGGCTAACAGC
AACCTGATATCCCAATTCCTACATCCGGGCCCTGTAGTGCATCGCGATACAGCGCTGCCACACCAGAGGCCCCGA
TCTGTCGACTCGTACTCGCCCTCTCTCCATTCGCCCTCGGTGTTCGCCACATCGCTGGGACCGAGGACGCAGACG
GAACCCGTAGCCGAAACGGGTGGGGACGAGTTGACGACACCCAGCTCGGCTTCATCGCACCACAAGCCGTTGAGG
TCAGGGACGTCGGCGTTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail