Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8288
Gene name
Locationscaffold_9:94756..98837
Strand-
Gene length (bp)4081
Transcript length (bp)3783
Coding sequence length (bp)3780
Protein length (aa) 1260

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01061 ABC2_membrane ABC-2 type transporter 2.6E-38 216 420
PF01061 ABC2_membrane ABC-2 type transporter 8.9E-35 913 1114
PF06422 PDR_CDR CDR ABC transporter 9.5E-26 432 518
PF00005 ABC_tran ABC transporter 4.1E-14 583 763
PF19055 ABC2_membrane_7 ABC-2 type transporter 5.9E-07 792 854

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74208|PDH1_CANGA ATP-binding cassette transporter CGR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PDH1 PE=3 SV=3 1 1224 0.0E+00
sp|O74676|CDR4_CANAX ABC transporter CDR4 OS=Candida albicans GN=CDR4 PE=3 SV=1 1 1214 0.0E+00
sp|P33302|PDR5_YEAST Pleiotropic ABC efflux transporter of multiple drugs OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR5 PE=1 SV=1 1 1221 0.0E+00
sp|P43071|CDR1_CANAX Multidrug resistance protein CDR1 OS=Candida albicans GN=CDR1 PE=3 SV=1 1 1214 0.0E+00
sp|Q5ANA3|CDR1_CANAL Pleiotropic ABC efflux transporter of multiple drugs CDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR1 PE=1 SV=1 1 1214 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74208|PDH1_CANGA ATP-binding cassette transporter CGR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PDH1 PE=3 SV=3 1 1224 0.0E+00
sp|O74676|CDR4_CANAX ABC transporter CDR4 OS=Candida albicans GN=CDR4 PE=3 SV=1 1 1214 0.0E+00
sp|P33302|PDR5_YEAST Pleiotropic ABC efflux transporter of multiple drugs OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR5 PE=1 SV=1 1 1221 0.0E+00
sp|P43071|CDR1_CANAX Multidrug resistance protein CDR1 OS=Candida albicans GN=CDR1 PE=3 SV=1 1 1214 0.0E+00
sp|Q5ANA3|CDR1_CANAL Pleiotropic ABC efflux transporter of multiple drugs CDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR1 PE=1 SV=1 1 1214 0.0E+00
sp|P78595|CDR2_CANAL Multidrug resistance protein CDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR2 PE=3 SV=2 1 1214 0.0E+00
sp|Q04182|PDR15_YEAST ATP-dependent permease PDR15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR15 PE=1 SV=1 1 1224 0.0E+00
sp|P51533|PDR10_YEAST ATP-dependent permease PDR10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR10 PE=3 SV=1 1 1212 0.0E+00
sp|O42690|CDR3_CANAX Opaque-specific ABC transporter CDR3 OS=Candida albicans GN=CDR3 PE=2 SV=1 1 1214 0.0E+00
sp|P41820|BFR1_SCHPO Brefeldin A resistance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bfr1 PE=1 SV=1 4 1219 0.0E+00
sp|P32568|SNQ2_YEAST Protein SNQ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNQ2 PE=1 SV=2 3 1216 0.0E+00
sp|P53756|PDR18_YEAST ABC transporter ATP-binding protein/permease PDR18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR18 PE=3 SV=1 3 1190 0.0E+00
sp|Q02785|PDR12_YEAST ATP-dependent permease PDR12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR12 PE=1 SV=1 3 1254 0.0E+00
sp|Q8T675|ABCGJ_DICDI ABC transporter G family member 19 OS=Dictyostelium discoideum GN=abcG19 PE=3 SV=1 1 1211 0.0E+00
sp|Q54CG0|ABCGA_DICDI ABC transporter G family member 10 OS=Dictyostelium discoideum GN=abcG10 PE=3 SV=1 1 1209 0.0E+00
sp|Q8T673|ABCGL_DICDI ABC transporter G family member 21 OS=Dictyostelium discoideum GN=abcG21 PE=3 SV=1 1 1211 0.0E+00
sp|Q55DR1|ABCGE_DICDI ABC transporter G family member 14 OS=Dictyostelium discoideum GN=abcG14 PE=3 SV=1 1 1211 0.0E+00
sp|Q55DQ2|ABCGB_DICDI ABC transporter G family member 11 OS=Dictyostelium discoideum GN=abcG11 PE=3 SV=1 1 1211 0.0E+00
sp|Q556W2|ABCGH_DICDI ABC transporter G family member 17 OS=Dictyostelium discoideum GN=abcG17-1 PE=3 SV=1 1 1209 0.0E+00
sp|Q8T683|ABCG9_DICDI ABC transporter G family member 9 OS=Dictyostelium discoideum GN=abcG9 PE=3 SV=1 1 1211 0.0E+00
sp|Q55GB1|ABCGF_DICDI ABC transporter G family member 15 OS=Dictyostelium discoideum GN=abcG15 PE=3 SV=1 1 1211 0.0E+00
sp|Q08409|AUS1_YEAST ATP-dependent permease AUS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AUS1 PE=3 SV=1 4 1235 0.0E+00
sp|P40550|PDR11_YEAST ATP-dependent permease PDR11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR11 PE=1 SV=3 4 1235 0.0E+00
sp|Q9C0Y5|PDR1_SCHPO ATP-binding cassette transporter pdr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pdr1 PE=3 SV=1 4 1227 2.0E-180
sp|Q9NGP5|ABCG2_DICDI ABC transporter G family member 2 OS=Dictyostelium discoideum GN=abcG2 PE=1 SV=2 1 1211 3.0E-133
sp|Q9M9E1|AB40G_ARATH ABC transporter G family member 40 OS=Arabidopsis thaliana GN=ABCG40 PE=1 SV=1 1 1145 4.0E-126
sp|Q0JLC5|AB36G_ORYSJ ABC transporter G family member 36 OS=Oryza sativa subsp. japonica GN=ABCG36 PE=2 SV=1 1 1117 1.0E-124
sp|A2WSH0|AB36G_ORYSI ABC transporter G family member 36 OS=Oryza sativa subsp. indica GN=ABCG36 PE=2 SV=1 1 1117 1.0E-124
sp|Q8GU89|AB37G_ORYSJ ABC transporter G family member 37 OS=Oryza sativa subsp. japonica GN=ABCG37 PE=2 SV=1 1 1117 2.0E-124
sp|Q7PC80|AB34G_ORYSJ ABC transporter G family member 34 OS=Oryza sativa subsp. japonica GN=ABCG34 PE=3 SV=1 1 1117 3.0E-122
sp|Q7PC88|AB31G_ARATH ABC transporter G family member 31 OS=Arabidopsis thaliana GN=ABCG31 PE=1 SV=1 1 1117 5.0E-121
sp|Q94A18|AB29G_ARATH ABC transporter G family member 29 OS=Arabidopsis thaliana GN=ABCG29 PE=2 SV=2 1 1117 8.0E-121
sp|Q8GU85|AB40G_ORYSJ ABC transporter G family member 40 OS=Oryza sativa subsp. japonica GN=ABCG40 PE=3 SV=2 1 1115 2.0E-120
sp|Q8LQX2|AB32G_ORYSJ ABC transporter G family member 32 OS=Oryza sativa subsp. japonica GN=ABCG32 PE=2 SV=1 1 1117 5.0E-120
sp|Q8GU92|AB35G_ORYSJ ABC transporter G family member 35 OS=Oryza sativa subsp. japonica GN=ABCG35 PE=3 SV=1 1 1117 4.0E-119
sp|Q7FMW4|AB38G_ORYSJ ABC transporter G family member 38 OS=Oryza sativa subsp. japonica GN=ABCG38 PE=3 SV=1 1 1117 5.0E-119
sp|Q7PC82|AB42G_ARATH ABC transporter G family member 42 OS=Arabidopsis thaliana GN=ABCG42 PE=2 SV=1 1 1117 9.0E-119
sp|Q8GZ52|AB30G_ARATH ABC transporter G family member 30 OS=Arabidopsis thaliana GN=ABCG30 PE=2 SV=2 1 1117 1.0E-118
sp|Q76CU2|PDR1_TOBAC Pleiotropic drug resistance protein 1 OS=Nicotiana tabacum GN=PDR1 PE=2 SV=1 1 1126 2.0E-118
sp|Q8S628|AB51G_ORYSJ ABC transporter G family member 51 OS=Oryza sativa subsp. japonica GN=ABCG51 PE=3 SV=1 1 1117 3.0E-118
sp|O24367|TUR2_SPIPO Pleiotropic drug resistance protein TUR2 OS=Spirodela polyrhiza GN=TUR2 PE=1 SV=1 1 1131 8.0E-118
sp|Q8GU88|AB39G_ORYSJ ABC transporter G family member 39 OS=Oryza sativa subsp. japonica GN=ABCG39 PE=3 SV=1 1 1117 2.0E-117
sp|Q7PC81|AB43G_ARATH ABC transporter G family member 43 OS=Arabidopsis thaliana GN=ABCG43 PE=3 SV=1 1 1117 4.0E-117
sp|Q9LFH0|AB37G_ARATH ABC transporter G family member 37 OS=Arabidopsis thaliana GN=ABCG37 PE=2 SV=1 1 1117 5.0E-117
sp|Q7PC86|AB35G_ARATH ABC transporter G family member 35 OS=Arabidopsis thaliana GN=ABCG35 PE=2 SV=1 1 1143 6.0E-117
sp|Q6EQ60|AB47G_ORYSJ ABC transporter G family member 47 OS=Oryza sativa subsp. japonica GN=ABCG47 PE=3 SV=2 1 1117 1.0E-116
sp|Q8GU84|AB48G_ORYSJ ABC transporter G family member 48 OS=Oryza sativa subsp. japonica GN=ABCG48 PE=3 SV=1 1 1115 1.0E-116
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 6 855 4.0E-116
sp|Q9ZUT8|AB33G_ARATH ABC transporter G family member 33 OS=Arabidopsis thaliana GN=ABCG33 PE=2 SV=1 1 1117 1.0E-115
sp|Q5W274|PDR3_TOBAC Pleiotropic drug resistance protein 3 OS=Nicotiana tabacum GN=PDR3 PE=2 SV=1 1 1117 5.0E-115
sp|Q949G3|PDR1_NICPL Pleiotropic drug resistance protein 1 OS=Nicotiana plumbaginifolia GN=PDR1 PE=1 SV=1 1 1117 6.0E-115
sp|Q2QV81|AB49G_ORYSJ ABC transporter G family member 49 OS=Oryza sativa subsp. japonica GN=ABCG49 PE=2 SV=3 1 1115 1.0E-114
sp|Q5Z9S8|AB42G_ORYSJ ABC transporter G family member 42 OS=Oryza sativa subsp. japonica GN=ABCG42 PE=2 SV=1 1 1117 1.0E-114
sp|B9G300|AB52G_ORYSJ ABC transporter G family member 52 OS=Oryza sativa subsp. japonica GN=ABCG52 PE=2 SV=2 1 1117 2.0E-114
sp|B9GDE5|AB50G_ORYSJ ABC transporter G family member 50 OS=Oryza sativa subsp. japonica GN=ABCG50 PE=2 SV=2 1 1114 3.0E-114
sp|A3BXL8|AB53G_ORYSJ ABC transporter G family member 53 OS=Oryza sativa subsp. japonica GN=ABCG53 PE=2 SV=1 1 1117 5.0E-114
sp|Q7PC83|AB41G_ARATH ABC transporter G family member 41 OS=Arabidopsis thaliana GN=ABCG41 PE=2 SV=1 1 1117 1.0E-113
sp|Q8GU87|AB31G_ORYSJ ABC transporter G family member 31 OS=Oryza sativa subsp. japonica GN=ABCG31 PE=2 SV=3 1 1120 4.0E-113
sp|Q8GU86|AB43G_ORYSJ ABC transporter G family member 43 OS=Oryza sativa subsp. japonica GN=ABCG43 PE=2 SV=2 1 1129 1.0E-112
sp|Q7PC87|AB34G_ARATH ABC transporter G family member 34 OS=Arabidopsis thaliana GN=ABCG34 PE=2 SV=1 1 1118 1.0E-112
sp|Q9XIE2|AB36G_ARATH ABC transporter G family member 36 OS=Arabidopsis thaliana GN=ABCG36 PE=1 SV=1 1 1117 2.0E-112
sp|Q8GU83|AB41G_ORYSJ ABC transporter G family member 41 OS=Oryza sativa subsp. japonica GN=ABCG41 PE=3 SV=1 1 1118 1.0E-111
sp|Q8GU82|AB45G_ORYSJ ABC transporter G family member 45 OS=Oryza sativa subsp. japonica GN=ABCG45 PE=2 SV=2 1 1118 3.0E-110
sp|Q6YW62|AB44G_ORYSJ ABC transporter G family member 44 OS=Oryza sativa subsp. japonica GN=ABCG44 PE=2 SV=2 1 1117 3.0E-110
sp|Q7PC84|AB39G_ARATH ABC transporter G family member 39 OS=Arabidopsis thaliana GN=ABCG39 PE=3 SV=1 1 1118 5.0E-110
sp|O81016|AB32G_ARATH ABC transporter G family member 32 OS=Arabidopsis thaliana GN=ABCG32 PE=1 SV=1 1 1126 1.0E-108
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 1 851 9.0E-104
sp|Q7PC85|AB38G_ARATH ABC transporter G family member 38 OS=Arabidopsis thaliana GN=ABCG38 PE=2 SV=1 1 1109 2.0E-101
sp|Q2PCF1|PDR2_NICPL Pleiotropic drug resistance protein 2 OS=Nicotiana plumbaginifolia GN=PDR2 PE=2 SV=1 1 1146 1.0E-100
sp|C7J6G6|AB46G_ORYSJ ABC transporter G family member 46 OS=Oryza sativa subsp. japonica GN=ABCG46 PE=3 SV=2 12 1117 1.0E-96
sp|Q8T690|ABCG3_DICDI ABC transporter G family member 3 OS=Dictyostelium discoideum GN=abcG3 PE=3 SV=1 581 1128 1.0E-63
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 529 1215 6.0E-63
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 576 1126 6.0E-62
sp|Q7TMS5|ABCG2_MOUSE ATP-binding cassette sub-family G member 2 OS=Mus musculus GN=Abcg2 PE=1 SV=1 540 1104 7.0E-52
sp|Q8T685|ABCGC_DICDI ABC transporter G family member 12 OS=Dictyostelium discoideum GN=abcG12 PE=3 SV=1 578 1140 1.0E-51
sp|P10090|WHITE_DROME Protein white OS=Drosophila melanogaster GN=w PE=2 SV=2 566 1135 1.0E-51
sp|Q05360|WHITE_LUCCU Protein white OS=Lucilia cuprina GN=W PE=2 SV=2 565 1135 9.0E-51
sp|Q80W57|ABCG2_RAT ATP-binding cassette sub-family G member 2 OS=Rattus norvegicus GN=Abcg2 PE=1 SV=1 559 1104 3.0E-50
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 1 496 1.0E-48
sp|Q4GZT4|ABCG2_BOVIN ATP-binding cassette sub-family G member 2 OS=Bos taurus GN=ABCG2 PE=3 SV=2 563 1107 3.0E-48
sp|Q17320|WHITE_CERCA Protein white OS=Ceratitis capitata GN=W PE=2 SV=1 565 1135 6.0E-48
sp|Q7XA72|AB21G_ARATH ABC transporter G family member 21 OS=Arabidopsis thaliana GN=ABCG21 PE=2 SV=2 510 1138 2.0E-47
sp|Q9UNQ0|ABCG2_HUMAN ATP-binding cassette sub-family G member 2 OS=Homo sapiens GN=ABCG2 PE=1 SV=3 563 1138 6.0E-47
sp|Q55DA0|ABCGM_DICDI ABC transporter G family member 22 OS=Dictyostelium discoideum GN=abcG22 PE=2 SV=1 565 1122 9.0E-47
sp|Q5MB13|ABCG2_MACMU ATP-binding cassette sub-family G member 2 OS=Macaca mulatta GN=ABCG2 PE=2 SV=1 563 1216 2.0E-46
sp|Q9NGP5|ABCG2_DICDI ABC transporter G family member 2 OS=Dictyostelium discoideum GN=abcG2 PE=1 SV=2 574 1184 3.0E-46
sp|Q80W57|ABCG2_RAT ATP-binding cassette sub-family G member 2 OS=Rattus norvegicus GN=Abcg2 PE=1 SV=1 4 495 3.0E-46
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 1 553 5.0E-46
sp|Q8T686|ABCG7_DICDI ABC transporter G family member 7 OS=Dictyostelium discoideum GN=abcG7 PE=3 SV=1 582 1122 7.0E-46
sp|Q93YS4|AB22G_ARATH ABC transporter G family member 22 OS=Arabidopsis thaliana GN=ABCG22 PE=1 SV=1 543 1105 8.0E-46
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 520 1198 9.0E-46
sp|Q8MIB3|ABCG2_PIG ATP-binding cassette sub-family G member 2 OS=Sus scrofa GN=ABCG2 PE=2 SV=1 539 1107 9.0E-46
sp|Q9M2V6|AB17G_ARATH ABC transporter G family member 17 OS=Arabidopsis thaliana GN=ABCG17 PE=2 SV=1 538 1208 5.0E-45
sp|Q86HQ2|ABCG8_DICDI ABC transporter G family member 8 OS=Dictyostelium discoideum GN=abcG8 PE=3 SV=1 582 1154 7.0E-45
sp|Q08234|YO075_YEAST Uncharacterized ABC transporter ATP-binding protein/permease YOL075C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL075C PE=1 SV=3 4 1017 7.0E-45
sp|Q9M3D6|AB19G_ARATH ABC transporter G family member 19 OS=Arabidopsis thaliana GN=ABCG19 PE=1 SV=1 526 1131 1.0E-44
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 544 1198 3.0E-44
sp|Q5MB13|ABCG2_MACMU ATP-binding cassette sub-family G member 2 OS=Macaca mulatta GN=ABCG2 PE=2 SV=1 4 495 1.0E-43
sp|Q7TMS5|ABCG2_MOUSE ATP-binding cassette sub-family G member 2 OS=Mus musculus GN=Abcg2 PE=1 SV=1 4 495 5.0E-43
sp|Q8MIB3|ABCG2_PIG ATP-binding cassette sub-family G member 2 OS=Sus scrofa GN=ABCG2 PE=2 SV=1 4 425 5.0E-43
sp|Q55DW4|ABCG1_DICDI ABC transporter G family member 1 OS=Dictyostelium discoideum GN=abcG1 PE=3 SV=1 581 854 7.0E-43
sp|Q4GZT4|ABCG2_BOVIN ATP-binding cassette sub-family G member 2 OS=Bos taurus GN=ABCG2 PE=3 SV=2 4 495 8.0E-43
sp|Q9M2V5|AB18G_ARATH ABC transporter G family member 18 OS=Arabidopsis thaliana GN=ABCG18 PE=2 SV=1 567 1207 9.0E-43
sp|Q27256|WHITE_ANOGA Protein white OS=Anopheles gambiae GN=w PE=2 SV=1 580 1124 2.0E-42
sp|Q9FNB5|AB6G_ARATH ABC transporter G family member 6 OS=Arabidopsis thaliana GN=ABCG6 PE=2 SV=1 564 1203 3.0E-42
sp|O80946|AB1G_ARATH ABC transporter G family member 1 OS=Arabidopsis thaliana GN=ABCG1 PE=2 SV=1 567 1117 5.0E-42
sp|Q9M2V7|AB16G_ARATH ABC transporter G family member 16 OS=Arabidopsis thaliana GN=ABCG16 PE=2 SV=2 562 1143 5.0E-42
sp|P45843|SCRT_DROME Protein scarlet OS=Drosophila melanogaster GN=st PE=1 SV=3 560 1107 1.0E-41
sp|Q16928|WHITE_ANOAL Protein white OS=Anopheles albimanus GN=W PE=3 SV=1 564 1135 1.0E-41
sp|Q9ZUT0|AB2G_ARATH ABC transporter G family member 2 OS=Arabidopsis thaliana GN=ABCG2 PE=2 SV=1 582 1131 2.0E-41
sp|Q9SZR9|AB9G_ARATH ABC transporter G family member 9 OS=Arabidopsis thaliana GN=ABCG9 PE=3 SV=2 576 1013 2.0E-41
sp|Q9C6W5|AB14G_ARATH ABC transporter G family member 14 OS=Arabidopsis thaliana GN=ABCG14 PE=2 SV=1 536 1012 8.0E-41
sp|Q9LFG8|AB20G_ARATH ABC transporter G family member 20 OS=Arabidopsis thaliana GN=ABCG20 PE=2 SV=1 572 1122 8.0E-41
sp|Q9UNQ0|ABCG2_HUMAN ATP-binding cassette sub-family G member 2 OS=Homo sapiens GN=ABCG2 PE=1 SV=3 4 495 1.0E-40
sp|Q9FT51|AB27G_ARATH ABC transporter G family member 27 OS=Arabidopsis thaliana GN=ABCG27 PE=2 SV=1 540 1105 2.0E-40
sp|Q8RWI9|AB15G_ARATH ABC transporter G family member 15 OS=Arabidopsis thaliana GN=ABCG15 PE=2 SV=2 577 1058 2.0E-40
sp|Q8T689|ABCG4_DICDI ABC transporter G family member 4 OS=Dictyostelium discoideum GN=abcG4 PE=3 SV=1 553 1122 4.0E-40
sp|Q8T690|ABCG3_DICDI ABC transporter G family member 3 OS=Dictyostelium discoideum GN=abcG3 PE=3 SV=1 582 1184 2.0E-39
sp|Q8RXN0|AB11G_ARATH ABC transporter G family member 11 OS=Arabidopsis thaliana GN=ABCG11 PE=1 SV=1 564 1058 2.0E-39
sp|Q9ZU35|AB7G_ARATH ABC transporter G family member 7 OS=Arabidopsis thaliana GN=ABCG7 PE=2 SV=1 545 1082 2.0E-39
sp|Q54T02|ABCGO_DICDI ABC transporter G family member 24 OS=Dictyostelium discoideum GN=abcG24 PE=3 SV=1 578 855 2.0E-39
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 560 1212 3.0E-39
sp|Q8H8V7|AB5G_ORYSJ ABC transporter G family member 5 OS=Oryza sativa subsp. japonica GN=RCN1 PE=1 SV=1 528 1131 1.0E-37
sp|B8ALI0|AB5G_ORYSI ABC transporter G family member 5 OS=Oryza sativa subsp. indica GN=OsI_11044 PE=3 SV=1 528 1131 1.0E-37
sp|Q64343|ABCG1_MOUSE ATP-binding cassette sub-family G member 1 OS=Mus musculus GN=Abcg1 PE=1 SV=1 545 1130 1.0E-37
sp|Q9C8K2|AB12G_ARATH ABC transporter G family member 12 OS=Arabidopsis thaliana GN=ABCG12 PE=1 SV=1 577 1058 2.0E-36
sp|P45844|ABCG1_HUMAN ATP-binding cassette sub-family G member 1 OS=Homo sapiens GN=ABCG1 PE=1 SV=3 545 1111 2.0E-36
sp|Q99P81|ABCG3_MOUSE ATP-binding cassette sub-family G member 3 OS=Mus musculus GN=Abcg3 PE=1 SV=2 564 1184 8.0E-36
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 581 1204 9.0E-36
sp|Q11180|WHT1_CAEEL ABC transporter ATP-binding protein/permease wht-1 OS=Caenorhabditis elegans GN=wht-1 PE=2 SV=2 576 1109 1.0E-35
sp|Q9C8J8|AB13G_ARATH ABC transporter G family member 13 OS=Arabidopsis thaliana GN=ABCG13 PE=2 SV=1 576 914 2.0E-35
sp|Q9MAG3|AB24G_ARATH ABC transporter G family member 24 OS=Arabidopsis thaliana GN=ABCG24 PE=2 SV=2 573 853 3.0E-35
sp|Q9SJK6|WBC30_ARATH Putative white-brown complex homolog protein 30 OS=Arabidopsis thaliana GN=WBC30 PE=1 SV=3 573 853 3.0E-35
sp|Q9H172|ABCG4_HUMAN ATP-binding cassette sub-family G member 4 OS=Homo sapiens GN=ABCG4 PE=1 SV=2 565 1024 3.0E-34
sp|Q9SW08|AB4G_ARATH ABC transporter G family member 4 OS=Arabidopsis thaliana GN=ABCG4 PE=3 SV=1 582 1118 1.0E-33
sp|Q9LK50|AB26G_ARATH ABC transporter G family member 26 OS=Arabidopsis thaliana GN=ABCG26 PE=3 SV=2 580 859 2.0E-33
sp|Q9SIT6|AB5G_ARATH ABC transporter G family member 5 OS=Arabidopsis thaliana GN=ABCG5 PE=2 SV=1 574 1114 3.0E-33
sp|D4AYW0|ABCG1_ARTBC ABC transporter G family member ARB_01379 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01379 PE=1 SV=1 545 852 3.0E-33
sp|Q9FLX5|AB8G_ARATH ABC transporter G family member 8 OS=Arabidopsis thaliana GN=ABCG8 PE=2 SV=1 582 1114 4.0E-33
sp|Q84TH5|AB25G_ARATH ABC transporter G family member 25 OS=Arabidopsis thaliana GN=ABCG25 PE=2 SV=1 580 1004 7.0E-33
sp|P25371|ADP1_YEAST Probable ATP-dependent permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADP1 PE=1 SV=2 573 1043 7.0E-33
sp|P58428|ABCG8_RAT ATP-binding cassette sub-family G member 8 OS=Rattus norvegicus GN=Abcg8 PE=2 SV=2 590 1133 3.0E-32
sp|Q9MAH4|AB10G_ARATH ABC transporter G family member 10 OS=Arabidopsis thaliana GN=ABCG10 PE=3 SV=1 582 1105 5.0E-32
sp|Q8T690|ABCG3_DICDI ABC transporter G family member 3 OS=Dictyostelium discoideum GN=abcG3 PE=3 SV=1 4 484 2.0E-31
sp|Q9DBM0|ABCG8_MOUSE ATP-binding cassette sub-family G member 8 OS=Mus musculus GN=Abcg8 PE=2 SV=1 1 497 3.0E-31
sp|Q09466|WHT3_CAEEL ABC transporter ATP-binding protein/permease wht-3 OS=Caenorhabditis elegans GN=wht-3 PE=3 SV=1 565 975 3.0E-31
sp|P58428|ABCG8_RAT ATP-binding cassette sub-family G member 8 OS=Rattus norvegicus GN=Abcg8 PE=2 SV=2 1 496 3.0E-30
sp|Q8T685|ABCGC_DICDI ABC transporter G family member 12 OS=Dictyostelium discoideum GN=abcG12 PE=3 SV=1 5 447 5.0E-30
sp|Q9DBM0|ABCG8_MOUSE ATP-binding cassette sub-family G member 8 OS=Mus musculus GN=Abcg8 PE=2 SV=1 590 1116 2.0E-29
sp|Q9FF46|AB28G_ARATH ABC transporter G family member 28 OS=Arabidopsis thaliana GN=ABCG28 PE=3 SV=1 573 853 4.0E-29
sp|Q93YS4|AB22G_ARATH ABC transporter G family member 22 OS=Arabidopsis thaliana GN=ABCG22 PE=1 SV=1 4 421 1.0E-28
sp|Q3E9B8|AB23G_ARATH ABC transporter G family member 23 OS=Arabidopsis thaliana GN=ABCG23 PE=2 SV=1 582 1114 2.0E-28
sp|Q9H221|ABCG8_HUMAN ATP-binding cassette sub-family G member 8 OS=Homo sapiens GN=ABCG8 PE=1 SV=1 590 1105 4.0E-28
sp|Q55DA0|ABCGM_DICDI ABC transporter G family member 22 OS=Dictyostelium discoideum GN=abcG22 PE=2 SV=1 5 430 1.0E-26
sp|Q9H222|ABCG5_HUMAN ATP-binding cassette sub-family G member 5 OS=Homo sapiens GN=ABCG5 PE=1 SV=1 580 1030 3.0E-26
sp|Q99PE8|ABCG5_MOUSE ATP-binding cassette sub-family G member 5 OS=Mus musculus GN=Abcg5 PE=1 SV=1 580 1029 5.0E-26
sp|Q9FT51|AB27G_ARATH ABC transporter G family member 27 OS=Arabidopsis thaliana GN=ABCG27 PE=2 SV=1 4 421 7.0E-26
sp|Q9ZU35|AB7G_ARATH ABC transporter G family member 7 OS=Arabidopsis thaliana GN=ABCG7 PE=2 SV=1 4 426 1.0E-25
sp|Q9LFH0|AB37G_ARATH ABC transporter G family member 37 OS=Arabidopsis thaliana GN=ABCG37 PE=2 SV=1 550 1115 2.0E-25
sp|Q2QV81|AB49G_ORYSJ ABC transporter G family member 49 OS=Oryza sativa subsp. japonica GN=ABCG49 PE=2 SV=3 581 1115 2.0E-25
sp|Q7FMW4|AB38G_ORYSJ ABC transporter G family member 38 OS=Oryza sativa subsp. japonica GN=ABCG38 PE=3 SV=1 576 1116 3.0E-25
sp|Q9H221|ABCG8_HUMAN ATP-binding cassette sub-family G member 8 OS=Homo sapiens GN=ABCG8 PE=1 SV=1 1 496 4.0E-25
sp|Q7XA72|AB21G_ARATH ABC transporter G family member 21 OS=Arabidopsis thaliana GN=ABCG21 PE=2 SV=2 4 446 5.0E-25
sp|Q9C6W5|AB14G_ARATH ABC transporter G family member 14 OS=Arabidopsis thaliana GN=ABCG14 PE=2 SV=1 1 431 9.0E-25
sp|O74676|CDR4_CANAX ABC transporter CDR4 OS=Candida albicans GN=CDR4 PE=3 SV=1 546 1260 1.0E-24
sp|Q5W274|PDR3_TOBAC Pleiotropic drug resistance protein 3 OS=Nicotiana tabacum GN=PDR3 PE=2 SV=1 581 1115 1.0E-24
sp|Q8RXN0|AB11G_ARATH ABC transporter G family member 11 OS=Arabidopsis thaliana GN=ABCG11 PE=1 SV=1 5 410 2.0E-24
sp|Q86HQ2|ABCG8_DICDI ABC transporter G family member 8 OS=Dictyostelium discoideum GN=abcG8 PE=3 SV=1 5 428 4.0E-24
sp|Q9ZUU9|AB3G_ARATH ABC transporter G family member 3 OS=Arabidopsis thaliana GN=ABCG3 PE=1 SV=2 572 1114 4.0E-24
sp|Q8GU83|AB41G_ORYSJ ABC transporter G family member 41 OS=Oryza sativa subsp. japonica GN=ABCG41 PE=3 SV=1 576 1114 5.0E-24
sp|Q99PE7|ABCG5_RAT ATP-binding cassette sub-family G member 5 OS=Rattus norvegicus GN=Abcg5 PE=2 SV=3 580 1029 2.0E-23
sp|Q08234|YO075_YEAST Uncharacterized ABC transporter ATP-binding protein/permease YOL075C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL075C PE=1 SV=3 582 1111 3.0E-23
sp|Q556W2|ABCGH_DICDI ABC transporter G family member 17 OS=Dictyostelium discoideum GN=abcG17-1 PE=3 SV=1 526 1122 4.0E-23
sp|P78595|CDR2_CANAL Multidrug resistance protein CDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR2 PE=3 SV=2 582 1204 1.0E-22
sp|P45843|SCRT_DROME Protein scarlet OS=Drosophila melanogaster GN=st PE=1 SV=3 5 490 1.0E-22
sp|Q5Z9S8|AB42G_ORYSJ ABC transporter G family member 42 OS=Oryza sativa subsp. japonica GN=ABCG42 PE=2 SV=1 582 1116 2.0E-22
sp|Q8T686|ABCG7_DICDI ABC transporter G family member 7 OS=Dictyostelium discoideum GN=abcG7 PE=3 SV=1 5 427 2.0E-22
sp|Q9SZR9|AB9G_ARATH ABC transporter G family member 9 OS=Arabidopsis thaliana GN=ABCG9 PE=3 SV=2 1 427 2.0E-22
sp|B9GDE5|AB50G_ORYSJ ABC transporter G family member 50 OS=Oryza sativa subsp. japonica GN=ABCG50 PE=2 SV=2 582 1116 4.0E-22
sp|B9G300|AB52G_ORYSJ ABC transporter G family member 52 OS=Oryza sativa subsp. japonica GN=ABCG52 PE=2 SV=2 582 1118 6.0E-22
sp|Q8T683|ABCG9_DICDI ABC transporter G family member 9 OS=Dictyostelium discoideum GN=abcG9 PE=3 SV=1 581 1247 1.0E-21
sp|O74208|PDH1_CANGA ATP-binding cassette transporter CGR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PDH1 PE=3 SV=3 581 1206 2.0E-21
sp|Q8RWI9|AB15G_ARATH ABC transporter G family member 15 OS=Arabidopsis thaliana GN=ABCG15 PE=2 SV=2 4 410 3.0E-21
sp|Q7PC88|AB31G_ARATH ABC transporter G family member 31 OS=Arabidopsis thaliana GN=ABCG31 PE=1 SV=1 549 1115 4.0E-21
sp|Q8T690|ABCG3_DICDI ABC transporter G family member 3 OS=Dictyostelium discoideum GN=abcG3 PE=3 SV=1 1 495 4.0E-21
sp|P25371|ADP1_YEAST Probable ATP-dependent permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADP1 PE=1 SV=2 15 366 6.0E-21
sp|Q9C8K2|AB12G_ARATH ABC transporter G family member 12 OS=Arabidopsis thaliana GN=ABCG12 PE=1 SV=1 4 508 7.0E-21
sp|O42690|CDR3_CANAX Opaque-specific ABC transporter CDR3 OS=Candida albicans GN=CDR3 PE=2 SV=1 582 1243 1.0E-20
sp|Q8GU88|AB39G_ORYSJ ABC transporter G family member 39 OS=Oryza sativa subsp. japonica GN=ABCG39 PE=3 SV=1 555 1115 1.0E-20
sp|P43071|CDR1_CANAX Multidrug resistance protein CDR1 OS=Candida albicans GN=CDR1 PE=3 SV=1 582 1204 2.0E-20
sp|Q5ANA3|CDR1_CANAL Pleiotropic ABC efflux transporter of multiple drugs CDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR1 PE=1 SV=1 582 1204 2.0E-20
sp|Q9FLX5|AB8G_ARATH ABC transporter G family member 8 OS=Arabidopsis thaliana GN=ABCG8 PE=2 SV=1 1 427 2.0E-20
sp|Q84TH5|AB25G_ARATH ABC transporter G family member 25 OS=Arabidopsis thaliana GN=ABCG25 PE=2 SV=1 4 420 2.0E-20
sp|Q9H222|ABCG5_HUMAN ATP-binding cassette sub-family G member 5 OS=Homo sapiens GN=ABCG5 PE=1 SV=1 1 503 3.0E-20
sp|Q8T689|ABCG4_DICDI ABC transporter G family member 4 OS=Dictyostelium discoideum GN=abcG4 PE=3 SV=1 5 427 4.0E-20
sp|Q17320|WHITE_CERCA Protein white OS=Ceratitis capitata GN=W PE=2 SV=1 19 419 6.0E-20
sp|Q99PE8|ABCG5_MOUSE ATP-binding cassette sub-family G member 5 OS=Mus musculus GN=Abcg5 PE=1 SV=1 1 490 7.0E-20
sp|Q9M9E1|AB40G_ARATH ABC transporter G family member 40 OS=Arabidopsis thaliana GN=ABCG40 PE=1 SV=1 555 1129 1.0E-19
sp|Q7PC81|AB43G_ARATH ABC transporter G family member 43 OS=Arabidopsis thaliana GN=ABCG43 PE=3 SV=1 582 1115 1.0E-19
sp|Q9C8J8|AB13G_ARATH ABC transporter G family member 13 OS=Arabidopsis thaliana GN=ABCG13 PE=2 SV=1 5 425 1.0E-19
sp|Q8GZ52|AB30G_ARATH ABC transporter G family member 30 OS=Arabidopsis thaliana GN=ABCG30 PE=2 SV=2 582 1114 2.0E-19
sp|Q8S628|AB51G_ORYSJ ABC transporter G family member 51 OS=Oryza sativa subsp. japonica GN=ABCG51 PE=3 SV=1 582 1105 2.0E-19
sp|Q949G3|PDR1_NICPL Pleiotropic drug resistance protein 1 OS=Nicotiana plumbaginifolia GN=PDR1 PE=1 SV=1 555 1118 2.0E-19
sp|Q7PC83|AB41G_ARATH ABC transporter G family member 41 OS=Arabidopsis thaliana GN=ABCG41 PE=2 SV=1 582 1115 2.0E-19
sp|Q7PC87|AB34G_ARATH ABC transporter G family member 34 OS=Arabidopsis thaliana GN=ABCG34 PE=2 SV=1 576 1145 2.0E-19
sp|P10090|WHITE_DROME Protein white OS=Drosophila melanogaster GN=w PE=2 SV=2 4 420 2.0E-19
sp|Q11180|WHT1_CAEEL ABC transporter ATP-binding protein/permease wht-1 OS=Caenorhabditis elegans GN=wht-1 PE=2 SV=2 5 499 2.0E-19
sp|Q9LK50|AB26G_ARATH ABC transporter G family member 26 OS=Arabidopsis thaliana GN=ABCG26 PE=3 SV=2 4 429 2.0E-19
sp|Q7PC82|AB42G_ARATH ABC transporter G family member 42 OS=Arabidopsis thaliana GN=ABCG42 PE=2 SV=1 576 1115 3.0E-19
sp|Q6EQ60|AB47G_ORYSJ ABC transporter G family member 47 OS=Oryza sativa subsp. japonica GN=ABCG47 PE=3 SV=2 576 1115 3.0E-19
sp|A3BXL8|AB53G_ORYSJ ABC transporter G family member 53 OS=Oryza sativa subsp. japonica GN=ABCG53 PE=2 SV=1 582 1115 3.0E-19
sp|Q8GU86|AB43G_ORYSJ ABC transporter G family member 43 OS=Oryza sativa subsp. japonica GN=ABCG43 PE=2 SV=2 581 1105 5.0E-19
sp|Q9SW08|AB4G_ARATH ABC transporter G family member 4 OS=Arabidopsis thaliana GN=ABCG4 PE=3 SV=1 4 427 8.0E-19
sp|Q8GU89|AB37G_ORYSJ ABC transporter G family member 37 OS=Oryza sativa subsp. japonica GN=ABCG37 PE=2 SV=1 582 1115 1.0E-18
sp|O24367|TUR2_SPIPO Pleiotropic drug resistance protein TUR2 OS=Spirodela polyrhiza GN=TUR2 PE=1 SV=1 555 1115 1.0E-18
sp|P41820|BFR1_SCHPO Brefeldin A resistance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bfr1 PE=1 SV=1 580 1205 2.0E-18
sp|Q7PC80|AB34G_ORYSJ ABC transporter G family member 34 OS=Oryza sativa subsp. japonica GN=ABCG34 PE=3 SV=1 581 1105 2.0E-18
sp|Q9ZUT8|AB33G_ARATH ABC transporter G family member 33 OS=Arabidopsis thaliana GN=ABCG33 PE=2 SV=1 581 1115 2.0E-18
sp|Q04182|PDR15_YEAST ATP-dependent permease PDR15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR15 PE=1 SV=1 581 1251 3.0E-18
sp|Q9SIT6|AB5G_ARATH ABC transporter G family member 5 OS=Arabidopsis thaliana GN=ABCG5 PE=2 SV=1 4 503 3.0E-18
sp|Q9XIE2|AB36G_ARATH ABC transporter G family member 36 OS=Arabidopsis thaliana GN=ABCG36 PE=1 SV=1 582 1115 4.0E-18
sp|Q05360|WHITE_LUCCU Protein white OS=Lucilia cuprina GN=W PE=2 SV=2 19 429 4.0E-18
sp|Q7PC85|AB38G_ARATH ABC transporter G family member 38 OS=Arabidopsis thaliana GN=ABCG38 PE=2 SV=1 551 1118 6.0E-18
sp|Q8LQX2|AB32G_ORYSJ ABC transporter G family member 32 OS=Oryza sativa subsp. japonica GN=ABCG32 PE=2 SV=1 582 1115 1.0E-17
sp|Q76CU2|PDR1_TOBAC Pleiotropic drug resistance protein 1 OS=Nicotiana tabacum GN=PDR1 PE=2 SV=1 582 1118 1.0E-17
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 1 429 1.0E-17
sp|Q9M2V6|AB17G_ARATH ABC transporter G family member 17 OS=Arabidopsis thaliana GN=ABCG17 PE=2 SV=1 4 420 1.0E-17
sp|Q9ZUU9|AB3G_ARATH ABC transporter G family member 3 OS=Arabidopsis thaliana GN=ABCG3 PE=1 SV=2 15 502 1.0E-17
sp|Q8T673|ABCGL_DICDI ABC transporter G family member 21 OS=Dictyostelium discoideum GN=abcG21 PE=3 SV=1 576 1134 2.0E-17
sp|Q55DQ2|ABCGB_DICDI ABC transporter G family member 11 OS=Dictyostelium discoideum GN=abcG11 PE=3 SV=1 582 1125 2.0E-17
sp|Q8GU84|AB48G_ORYSJ ABC transporter G family member 48 OS=Oryza sativa subsp. japonica GN=ABCG48 PE=3 SV=1 582 1135 2.0E-17
sp|Q08234|YO075_YEAST Uncharacterized ABC transporter ATP-binding protein/permease YOL075C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL075C PE=1 SV=3 4 427 2.0E-17
sp|Q9H172|ABCG4_HUMAN ATP-binding cassette sub-family G member 4 OS=Homo sapiens GN=ABCG4 PE=1 SV=2 1 416 2.0E-17
sp|Q55DW4|ABCG1_DICDI ABC transporter G family member 1 OS=Dictyostelium discoideum GN=abcG1 PE=3 SV=1 5 136 3.0E-17
sp|Q99PE7|ABCG5_RAT ATP-binding cassette sub-family G member 5 OS=Rattus norvegicus GN=Abcg5 PE=2 SV=3 4 497 3.0E-17
sp|Q3E9B8|AB23G_ARATH ABC transporter G family member 23 OS=Arabidopsis thaliana GN=ABCG23 PE=2 SV=1 15 429 4.0E-17
sp|Q55DR1|ABCGE_DICDI ABC transporter G family member 14 OS=Dictyostelium discoideum GN=abcG14 PE=3 SV=1 582 1125 5.0E-17
sp|Q02785|PDR12_YEAST ATP-dependent permease PDR12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR12 PE=1 SV=1 580 1202 8.0E-17
sp|Q2PCF1|PDR2_NICPL Pleiotropic drug resistance protein 2 OS=Nicotiana plumbaginifolia GN=PDR2 PE=2 SV=1 576 1117 8.0E-17
sp|Q27256|WHITE_ANOGA Protein white OS=Anopheles gambiae GN=w PE=2 SV=1 19 420 8.0E-17
sp|O65934|ABC1_MYCTU ABC transporter ATP-binding/permease protein Rv1747 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1747 PE=1 SV=1 580 818 8.0E-17
sp|P51533|PDR10_YEAST ATP-dependent permease PDR10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR10 PE=3 SV=1 574 1191 1.0E-16
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 1 429 1.0E-16
sp|Q9M2V5|AB18G_ARATH ABC transporter G family member 18 OS=Arabidopsis thaliana GN=ABCG18 PE=2 SV=1 4 420 1.0E-16
sp|Q7PC86|AB35G_ARATH ABC transporter G family member 35 OS=Arabidopsis thaliana GN=ABCG35 PE=2 SV=1 582 1115 2.0E-16
sp|Q7PC84|AB39G_ARATH ABC transporter G family member 39 OS=Arabidopsis thaliana GN=ABCG39 PE=3 SV=1 576 1145 2.0E-16
sp|Q99P81|ABCG3_MOUSE ATP-binding cassette sub-family G member 3 OS=Mus musculus GN=Abcg3 PE=1 SV=2 27 425 2.0E-16
sp|P53756|PDR18_YEAST ABC transporter ATP-binding protein/permease PDR18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR18 PE=3 SV=1 576 1259 3.0E-16
sp|Q0JLC5|AB36G_ORYSJ ABC transporter G family member 36 OS=Oryza sativa subsp. japonica GN=ABCG36 PE=2 SV=1 582 1115 3.0E-16
sp|A2WSH0|AB36G_ORYSI ABC transporter G family member 36 OS=Oryza sativa subsp. indica GN=ABCG36 PE=2 SV=1 582 1115 3.0E-16
sp|Q8GU92|AB35G_ORYSJ ABC transporter G family member 35 OS=Oryza sativa subsp. japonica GN=ABCG35 PE=3 SV=1 582 1115 3.0E-16
sp|P45844|ABCG1_HUMAN ATP-binding cassette sub-family G member 1 OS=Homo sapiens GN=ABCG1 PE=1 SV=3 1 416 3.0E-16
sp|Q9ZUT0|AB2G_ARATH ABC transporter G family member 2 OS=Arabidopsis thaliana GN=ABCG2 PE=2 SV=1 4 421 6.0E-16
sp|Q54CG0|ABCGA_DICDI ABC transporter G family member 10 OS=Dictyostelium discoideum GN=abcG10 PE=3 SV=1 565 1123 8.0E-16
sp|Q8GU85|AB40G_ORYSJ ABC transporter G family member 40 OS=Oryza sativa subsp. japonica GN=ABCG40 PE=3 SV=2 578 1115 2.0E-15
sp|Q8GU82|AB45G_ORYSJ ABC transporter G family member 45 OS=Oryza sativa subsp. japonica GN=ABCG45 PE=2 SV=2 576 1117 2.0E-15
sp|Q8H8V7|AB5G_ORYSJ ABC transporter G family member 5 OS=Oryza sativa subsp. japonica GN=RCN1 PE=1 SV=1 4 420 4.0E-15
sp|Q9MAH4|AB10G_ARATH ABC transporter G family member 10 OS=Arabidopsis thaliana GN=ABCG10 PE=3 SV=1 4 487 5.0E-15
sp|B8ALI0|AB5G_ORYSI ABC transporter G family member 5 OS=Oryza sativa subsp. indica GN=OsI_11044 PE=3 SV=1 4 420 6.0E-15
sp|Q6YW62|AB44G_ORYSJ ABC transporter G family member 44 OS=Oryza sativa subsp. japonica GN=ABCG44 PE=2 SV=2 576 1115 9.0E-15
sp|Q94A18|AB29G_ARATH ABC transporter G family member 29 OS=Arabidopsis thaliana GN=ABCG29 PE=2 SV=2 582 1115 1.0E-14
sp|Q9M3D6|AB19G_ARATH ABC transporter G family member 19 OS=Arabidopsis thaliana GN=ABCG19 PE=1 SV=1 4 420 1.0E-14
sp|D4AYW0|ABCG1_ARTBC ABC transporter G family member ARB_01379 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01379 PE=1 SV=1 4 135 1.0E-14
sp|P33302|PDR5_YEAST Pleiotropic ABC efflux transporter of multiple drugs OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR5 PE=1 SV=1 581 1191 2.0E-14
sp|P53756|PDR18_YEAST ABC transporter ATP-binding protein/permease PDR18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR18 PE=3 SV=1 21 480 3.0E-14
sp|Q9M2V7|AB16G_ARATH ABC transporter G family member 16 OS=Arabidopsis thaliana GN=ABCG16 PE=2 SV=2 4 420 9.0E-14
sp|Q8T675|ABCGJ_DICDI ABC transporter G family member 19 OS=Dictyostelium discoideum GN=abcG19 PE=3 SV=1 576 1252 2.0E-13
sp|O80946|AB1G_ARATH ABC transporter G family member 1 OS=Arabidopsis thaliana GN=ABCG1 PE=2 SV=1 4 420 2.0E-13
sp|Q7FMW4|AB38G_ORYSJ ABC transporter G family member 38 OS=Oryza sativa subsp. japonica GN=ABCG38 PE=3 SV=1 14 495 1.0E-12
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 1 422 2.0E-12
sp|C7J6G6|AB46G_ORYSJ ABC transporter G family member 46 OS=Oryza sativa subsp. japonica GN=ABCG46 PE=3 SV=2 582 1115 2.0E-12
sp|Q9FNB5|AB6G_ARATH ABC transporter G family member 6 OS=Arabidopsis thaliana GN=ABCG6 PE=2 SV=1 4 427 3.0E-12
sp|Q9LFG8|AB20G_ARATH ABC transporter G family member 20 OS=Arabidopsis thaliana GN=ABCG20 PE=2 SV=1 4 421 3.0E-12
sp|Q8SQU5|YBD4_ENCCU ABC transporter-like protein ECU11_1340 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU11_1340 PE=1 SV=1 578 856 3.0E-12
sp|Q16928|WHITE_ANOAL Protein white OS=Anopheles albimanus GN=W PE=3 SV=1 19 424 6.0E-12
sp|Q55GB1|ABCGF_DICDI ABC transporter G family member 15 OS=Dictyostelium discoideum GN=abcG15 PE=3 SV=1 510 898 2.0E-11
sp|Q64343|ABCG1_MOUSE ATP-binding cassette sub-family G member 1 OS=Mus musculus GN=Abcg1 PE=1 SV=1 1 148 2.0E-11
sp|Q8T674|ABCGK_DICDI ABC transporter G family member 20 OS=Dictyostelium discoideum GN=abcG20 PE=3 SV=1 576 792 8.0E-11
sp|Q8GU84|AB48G_ORYSJ ABC transporter G family member 48 OS=Oryza sativa subsp. japonica GN=ABCG48 PE=3 SV=1 1 442 1.0E-10
sp|Q50801|Y583_METTM Putative ABC transporter ATP-binding protein MTBMA_c05830 OS=Methanothermobacter marburgensis (strain DSM 2133 / 14651 / NBRC 100331 / OCM 82 / Marburg) GN=MTBMA_c05830 PE=3 SV=2 579 822 1.0E-10
sp|P40550|PDR11_YEAST ATP-dependent permease PDR11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR11 PE=1 SV=3 677 1205 2.0E-09
sp|O34697|BCEA_BACSU Bacitracin export ATP-binding protein BceA OS=Bacillus subtilis (strain 168) GN=bceA PE=2 SV=1 580 835 2.0E-09
sp|Q9CL63|RBSA2_PASMU Ribose import ATP-binding protein RbsA 2 OS=Pasteurella multocida (strain Pm70) GN=rbsA2 PE=3 SV=1 573 811 8.0E-09
sp|Q54T02|ABCGO_DICDI ABC transporter G family member 24 OS=Dictyostelium discoideum GN=abcG24 PE=3 SV=1 4 117 1.0E-08
sp|Q9SJK6|WBC30_ARATH Putative white-brown complex homolog protein 30 OS=Arabidopsis thaliana GN=WBC30 PE=1 SV=3 4 129 1.0E-08
sp|D4AYW0|ABCG1_ARTBC ABC transporter G family member ARB_01379 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01379 PE=1 SV=1 877 1115 1.0E-08
sp|Q9WYC4|Y288_THEMA Uncharacterized ABC transporter ATP-binding protein TM_0288 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0288 PE=1 SV=1 562 818 2.0E-08
sp|P45861|YWJA_BACSU Uncharacterized ABC transporter ATP-binding protein YwjA OS=Bacillus subtilis (strain 168) GN=ywjA PE=3 SV=1 581 813 2.0E-08
sp|Q8KFD6|Y391_CHLTE Putative ABC transporter ATP-binding protein CT0391 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=CT0391 PE=3 SV=1 583 820 3.0E-08
sp|Q1MHS1|RBSA1_RHIL3 Ribose import ATP-binding protein RbsA 1 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=rbsA1 PE=3 SV=2 590 788 4.0E-08
sp|O35600|ABCA4_MOUSE Retinal-specific ATP-binding cassette transporter OS=Mus musculus GN=Abca4 PE=2 SV=1 543 792 4.0E-08
sp|Q737I0|Y2668_BACC1 Putative ABC transporter ATP-binding protein BCE_2668 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=BCE_2668 PE=3 SV=1 580 811 4.0E-08
sp|Q6HI76|Y2424_BACHK Putative ABC transporter ATP-binding protein BT9727_2424 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=BT9727_2424 PE=3 SV=1 558 811 5.0E-08
sp|Q81PZ8|Y2641_BACAN Putative ABC transporter ATP-binding protein BA_2641/GBAA_2641/BAS2461 OS=Bacillus anthracis GN=BA_2641 PE=3 SV=1 580 811 7.0E-08
sp|Q2SIN5|MSBA_HAHCH Lipid A export ATP-binding/permease protein MsbA OS=Hahella chejuensis (strain KCTC 2396) GN=msbA PE=3 SV=1 528 811 9.0E-08
sp|Q6KHL2|ECFA2_MYCMO Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=ecfA2 PE=3 SV=1 593 792 9.0E-08
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 206 428 1.0E-07
sp|Q8XXB6|MSBA_RALSO Lipid A export ATP-binding/permease protein MsbA OS=Ralstonia solanacearum (strain GMI1000) GN=msbA PE=3 SV=1 579 811 1.0E-07
sp|Q81CT8|Y2655_BACCR Putative ABC transporter ATP-binding protein BC_2655 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=BC_2655 PE=3 SV=2 580 827 2.0E-07
sp|O26236|Y133_METTH Putative ABC transporter ATP-binding protein MTH_133 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_133 PE=3 SV=1 568 811 2.0E-07
sp|P0A9V4|LPTB_SHIFL Lipopolysaccharide export system ATP-binding protein LptB OS=Shigella flexneri GN=lptB PE=3 SV=2 578 793 2.0E-07
sp|P0A9V1|LPTB_ECOLI Lipopolysaccharide export system ATP-binding protein LptB OS=Escherichia coli (strain K12) GN=lptB PE=1 SV=2 578 793 2.0E-07
sp|P0A9V2|LPTB_ECOL6 Lipopolysaccharide export system ATP-binding protein LptB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=lptB PE=3 SV=2 578 793 2.0E-07
sp|P0A9V3|LPTB_ECO57 Lipopolysaccharide export system ATP-binding protein LptB OS=Escherichia coli O157:H7 GN=lptB PE=3 SV=2 578 793 2.0E-07
sp|Q46717|HLYB_ECO57 Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli O157:H7 GN=hlyB PE=3 SV=2 572 811 2.0E-07
sp|P78363|ABCA4_HUMAN Retinal-specific ATP-binding cassette transporter OS=Homo sapiens GN=ABCA4 PE=1 SV=3 543 792 2.0E-07
sp|Q04473|RTX3B_ACTPL Toxin RTX-III translocation ATP-binding protein OS=Actinobacillus pleuropneumoniae GN=apxIIIB PE=3 SV=1 582 811 2.0E-07
sp|Q2NHA1|ECFA_METST Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=ecfA PE=3 SV=1 561 803 3.0E-07
sp|Q9CHL8|LMRA_LACLA Multidrug resistance ABC transporter ATP-binding and permease protein OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=lmrA PE=1 SV=2 527 814 3.0E-07
sp|Q329G7|RBSA_SHIDS Ribose import ATP-binding protein RbsA OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rbsA PE=3 SV=1 583 811 4.0E-07
sp|Q9MAG3|AB24G_ARATH ABC transporter G family member 24 OS=Arabidopsis thaliana GN=ABCG24 PE=2 SV=2 4 134 5.0E-07
sp|Q9RCG7|PAXB_PASAE Exotoxin translocation ATP-binding protein PaxB OS=Pasteurella aerogenes GN=paxB PE=3 SV=1 582 811 5.0E-07
sp|Q4UMZ3|Y214_RICFE Putative export ATP-binding/permease protein RF_0214 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0214 PE=3 SV=2 581 824 5.0E-07
sp|Q65E55|RBSA_BACLD Ribose import ATP-binding protein RbsA OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=rbsA PE=3 SV=1 568 826 6.0E-07
sp|Q54T02|ABCGO_DICDI ABC transporter G family member 24 OS=Dictyostelium discoideum GN=abcG24 PE=3 SV=1 243 422 7.0E-07
sp|Q9S472|ARAG_GEOSE L-arabinose transport ATP-binding protein AraG OS=Geobacillus stearothermophilus GN=araG PE=3 SV=1 580 825 9.0E-07
sp|Q81HW8|RBSA_BACCR Ribose import ATP-binding protein RbsA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=rbsA PE=3 SV=1 576 811 1.0E-06
sp|Q73KT5|Y2132_TREDE Putative ABC transporter ATP-binding protein TDE_2132 OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=TDE_2132 PE=3 SV=1 579 793 1.0E-06
sp|Q98K15|RBSA1_RHILO Ribose import ATP-binding protein RbsA 1 OS=Rhizobium loti (strain MAFF303099) GN=rbsA1 PE=3 SV=1 622 788 2.0E-06
sp|Q2K9A3|RBSA1_RHIEC Ribose import ATP-binding protein RbsA 1 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=rbsA1 PE=3 SV=1 684 788 2.0E-06
sp|Q2J534|PSTB_FRASC Phosphate import ATP-binding protein PstB OS=Frankia sp. (strain CcI3) GN=pstB PE=3 SV=1 586 780 2.0E-06
sp|Q9X051|RBSA2_THEMA Ribose import ATP-binding protein RbsA 2 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=rbsA2 PE=3 SV=1 578 817 2.0E-06
sp|O27739|ECFA_METTH Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=ecfA PE=3 SV=1 579 811 2.0E-06
sp|P63299|YTFR_ECO57 Uncharacterized ABC transporter ATP-binding protein YtfR OS=Escherichia coli O157:H7 GN=ytfR PE=3 SV=1 579 811 3.0E-06
sp|Q6BEX0|YTFR_ECOLI Uncharacterized ABC transporter ATP-binding protein YtfR OS=Escherichia coli (strain K12) GN=ytfR PE=3 SV=1 579 811 3.0E-06
sp|Q8R420|ABCA3_MOUSE ATP-binding cassette sub-family A member 3 OS=Mus musculus GN=Abca3 PE=1 SV=3 593 813 3.0E-06
sp|Q92CK1|Y1170_LISIN Putative ABC transporter ATP-binding protein lin1170 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lin1170 PE=3 SV=1 579 829 3.0E-06
sp|Q3MB44|RBSA_ANAVT Ribose import ATP-binding protein RbsA OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=rbsA PE=3 SV=1 573 854 4.0E-06
sp|Q7UU57|RBSA_RHOBA Ribose import ATP-binding protein RbsA OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=rbsA PE=3 SV=1 579 824 5.0E-06
sp|Q2KYS6|MSBA_BORA1 Lipid A export ATP-binding/permease protein MsbA OS=Bordetella avium (strain 197N) GN=msbA PE=3 SV=1 527 811 6.0E-06
sp|Q55DW4|ABCG1_DICDI ABC transporter G family member 1 OS=Dictyostelium discoideum GN=abcG1 PE=3 SV=1 170 499 7.0E-06
sp|P22638|HEPA_NOSS1 Heterocyst differentiation ATP-binding protein HepA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hepA PE=2 SV=3 582 811 7.0E-06
sp|Q56342|MGLA_TREPA Galactose/methyl galactoside import ATP-binding protein MglA OS=Treponema pallidum (strain Nichols) GN=mglA PE=3 SV=1 581 822 8.0E-06
sp|Q6HNE7|RBSA_BACHK Ribose import ATP-binding protein RbsA OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=rbsA PE=3 SV=1 576 811 1.0E-05
sp|Q81V36|RBSA_BACAN Ribose import ATP-binding protein RbsA OS=Bacillus anthracis GN=rbsA PE=3 SV=2 576 811 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0042626 ATPase-coupled transmembrane transporter activity Yes
GO:0140359 ABC-type transporter activity Yes
GO:0016020 membrane Yes
GO:0005524 ATP binding Yes
GO:0031224 intrinsic component of membrane No
GO:0140657 ATP-dependent activity No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0006810 transport No
GO:0022804 active transmembrane transporter activity No
GO:0051179 localization No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0008150 biological_process No
GO:0032553 ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0015399 primary active transmembrane transporter activity No
GO:0032559 adenyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0097159 organic cyclic compound binding No
GO:0097367 carbohydrate derivative binding No
GO:0000166 nucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0005575 cellular_component No
GO:1901363 heterocyclic compound binding No
GO:0017076 purine nucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0009987 cellular process No
GO:0005488 binding No
GO:0022857 transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

Domain # Start End Length
1 232 254 22
2 267 289 22
3 310 332 22
4 345 367 22
5 376 398 22
6 473 495 22
7 929 951 22
8 956 978 22
9 999 1021 22
10 1036 1053 17
11 1066 1088 22
12 1093 1115 22
13 1189 1211 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8288
MAVFGLSHTYHTKVGSDFVRGVSGGERKRVSIAEMVVAGSPLASWDNSTRGLDSATAFKFVQSLRMTCDLASQTN
LVAIYQASQAIYDLFDKATVLYEGRQIFFGPANRAHRFFEEQGWYCPPRQTTGDFLTSVTNPSERRARAGMEDRV
PRTAAEFEAYWRESADHQALLRELDEYDDGQHPGETIAQFRRQTEAIRAKHRVRRHSPYIISVGLQIGLNVKRAY
QRIRGDMTAKVAQTLADIFMALIIGSLFYNTPDATVGFYPKGAVLFMAVLMNALTAISEISGLYEQRPIVEKQRS
YAFYHPATEAFAGLVADIPIKFVTSAAFNLIVYFLANLHRSPGQFFLYYLIIFMTIFIMSAIFRTLAAATKTISQ
AMAFAGVMALALIMYTGFAIRIPQMHPWWINPIFYAFEILIANEFHGHQYTCSSIVPNYSPPVGNSFTCSVPGAV
AGQFTVSGDSFIKADYDYSWSHVWRNFGILCGFLIGFILIYLLTIELNSSTTSTAEALVFPRRHVPAHFKHGDQE
EKMEKGAASTGAVVQRSDDDDNDDEGSEIRALPAQTDIFTWRRVVYDIEIKGKGRRLLNHVDGWVKPGTLTALMG
VSGAGKTTLLDVLAHRTTMGVITGDMLVNGKPLDASFQRKTGYVQQQGITIMTWREINKGAKKGGRKGDTDTLDT
TDLHLATATVRESLRFSALLRQPDTISRKEKYEFVEDIIKMLNMEEFSNAVVGIPGEGLNVEQRKLLTIGVELAA
KPKLLLFLDEPTSGLDSQSSWAICSLLRKLADGGQAILCTVHQPSAILFQSFDRLLFLARGGMTVYFGDIGENSR
TLLDYFEAHGSRLCGDAENPAEFMLEVVNDGHNDAGEDWHTIWKSSREFQHVQEELDKMHAESVTEASDAEPVDG
RQLAEFAVPLTSQFVEVFWRLLQQYWRMPSYVFAKLLLGAFAGLFIGFTFFHAKKTLAGVQEVIYAVFTLLTVFT
TLVQQRALYEVRERPSKAYSWKAFIAANISVEIPFQVLTAIIIFGSFYYPIMGVQSTPRQGLVLLFVLQLLIYCS
AFADMTVVTMPDAHTAGSLATVLVLMSILFCGVLQSPIAMPGFWIFMYWLSPFTYWVSGIISTELHDQPISCTRT
EESTFDPPSGMSCGQYLQPFLQGGAPGHLDNPDALSQCQYCAYSTADQLLAGSWIYWNDRWRNYGIFWAYIVFDI
LIVVLVYYLFRVKQWSGTFSRVAKLVPKLRNPVEEVKEESMAPPESSSPGNDDKAVNPTG
Coding >Ophio5|8288
ATGGCCGTCTTCGGTCTCAGCCACACATACCACACCAAGGTCGGCAGCGACTTCGTCCGAGGCGTTTCCGGCGGC
GAGCGGAAACGCGTCAGTATCGCCGAGATGGTCGTGGCGGGATCGCCGCTGGCCTCGTGGGATAACAGCACCCGC
GGTCTCGACTCGGCTACGGCCTTCAAATTCGTCCAGTCTCTCCGTATGACGTGTGATCTCGCGTCACAGACCAAC
CTGGTAGCCATCTATCAAGCCAGCCAAGCCATCTACGACCTCTTCGACAAGGCCACCGTTCTATACGAGGGCCGT
CAGATCTTCTTCGGCCCAGCCAATCGCGCGCACCGCTTCTTCGAGGAACAAGGCTGGTATTGTCCTCCGCGTCAG
ACGACAGGCGACTTCCTGACGTCTGTGACGAACCCTTCGGAGCGACGAGCGCGGGCCGGAATGGAGGATCGCGTG
CCCCGGACGGCGGCAGAGTTTGAGGCCTACTGGAGAGAATCGGCAGACCATCAGGCGCTTCTGCGTGAGCTGGAT
GAATACGACGACGGCCAGCACCCCGGCGAGACCATCGCCCAGTTCCGTCGGCAGACAGAGGCCATTCGGGCAAAA
CACCGCGTACGGAGACATTCGCCCTACATCATCAGCGTCGGGCTGCAGATCGGACTCAACGTCAAGCGGGCTTAC
CAGCGGATCAGGGGCGATATGACTGCCAAGGTGGCCCAGACCCTGGCCGACATCTTCATGGCCCTCATCATCGGC
TCTCTCTTTTACAATACGCCCGACGCCACTGTCGGCTTCTATCCCAAGGGAGCGGTCCTGTTCATGGCCGTGTTG
ATGAACGCCTTGACGGCCATCTCCGAGATCAGCGGGTTGTACGAGCAGCGGCCGATTGTCGAGAAGCAACGGTCA
TATGCCTTCTATCATCCGGCCACCGAGGCTTTCGCCGGCTTGGTTGCCGATATCCCCATCAAGTTTGTCACCTCG
GCTGCTTTCAACCTGATAGTCTACTTTCTAGCGAACCTGCACCGGTCTCCGGGCCAGTTCTTCCTCTACTACCTC
ATCATCTTCATGACCATCTTCATCATGAGCGCCATCTTCCGCACCCTCGCCGCCGCCACCAAGACCATCTCCCAG
GCCATGGCCTTTGCGGGCGTCATGGCCTTGGCCCTCATCATGTACACGGGCTTCGCCATCCGGATCCCACAGATG
CATCCCTGGTGGATCAACCCCATCTTCTATGCCTTTGAGATCCTCATCGCCAACGAATTCCACGGCCACCAATAC
ACCTGCTCGAGCATCGTTCCCAACTACTCCCCTCCGGTCGGGAACTCGTTTACCTGCAGCGTGCCCGGCGCCGTT
GCCGGCCAGTTCACCGTCAGTGGCGACAGCTTCATCAAGGCCGACTACGACTACTCCTGGAGCCACGTGTGGAGA
AACTTTGGCATCCTCTGCGGCTTTCTCATCGGTTTCATCCTCATCTACCTCTTGACCATCGAGCTCAACTCGTCC
ACCACCAGCACAGCCGAGGCCCTCGTCTTCCCGCGTCGTCACGTTCCCGCTCATTTCAAACACGGTGACCAGGAG
GAGAAGATGGAGAAAGGTGCGGCCTCGACGGGCGCAGTCGTCCAGCGGTCCGACGACGACGACAACGACGACGAG
GGGTCCGAGATTCGCGCCCTGCCGGCTCAGACGGACATCTTCACCTGGCGTCGGGTCGTGTATGATATAGAGATC
AAGGGCAAGGGGCGTAGACTGCTCAACCACGTCGATGGCTGGGTCAAGCCCGGCACTCTGACGGCTCTCATGGGC
GTTTCAGGCGCGGGAAAGACGACGCTTCTCGACGTGCTCGCCCATAGAACCACCATGGGTGTCATCACCGGCGAC
ATGTTGGTCAACGGCAAGCCCTTGGATGCGAGCTTCCAGCGGAAGACGGGCTACGTTCAGCAGCAAGGTATTACC
ATCATGACTTGGAGGGAGATAAACAAAGGCGCAAAAAAAGGGGGCAGGAAGGGAGACACTGACACGTTGGACACT
ACAGATCTGCACTTGGCGACGGCCACGGTTCGAGAGAGCCTCCGATTCAGTGCCCTTCTTCGCCAACCCGACACA
ATCAGCAGAAAGGAAAAGTACGAGTTCGTTGAGGACATCATTAAGATGCTCAACATGGAGGAATTCTCCAACGCC
GTCGTCGGCATACCCGGAGAAGGCCTCAACGTAGAGCAACGCAAACTGCTGACCATCGGCGTCGAGCTGGCGGCC
AAGCCGAAACTCCTCCTCTTCCTGGACGAGCCGACCAGCGGTCTCGACTCACAAAGCTCATGGGCCATCTGCTCG
CTCCTGCGAAAGCTGGCCGACGGTGGTCAAGCCATCCTCTGCACCGTCCATCAGCCAAGCGCCATCCTCTTCCAG
TCTTTCGACCGCCTTCTCTTCCTCGCCAGGGGGGGAATGACGGTCTACTTTGGTGATATCGGGGAGAATTCACGC
ACGCTGCTTGATTATTTCGAGGCTCATGGCTCTCGTTTGTGCGGCGACGCTGAGAACCCGGCTGAGTTTATGCTC
GAGGTGGTGAATGACGGCCATAATGATGCGGGAGAGGATTGGCACACAATCTGGAAGTCCAGTCGCGAGTTTCAG
CATGTTCAGGAGGAGCTGGATAAGATGCATGCCGAGAGCGTCACCGAAGCATCCGACGCGGAGCCCGTCGACGGC
CGTCAGCTCGCCGAGTTCGCCGTCCCGCTTACGTCCCAGTTCGTCGAGGTCTTTTGGCGCTTGCTTCAGCAGTAC
TGGAGGATGCCGAGTTACGTGTTTGCCAAGTTGTTGCTCGGCGCCTTTGCTGGCCTCTTCATTGGCTTTACCTTT
TTCCATGCCAAGAAGACGCTGGCTGGGGTCCAGGAAGTCATCTACGCCGTCTTTACCCTCCTGACTGTGTTTACA
ACGCTCGTTCAGCAGCGAGCGCTGTACGAAGTCCGCGAACGACCCAGCAAGGCATATTCATGGAAAGCCTTTATT
GCTGCCAACATCTCAGTCGAGATACCCTTTCAGGTTCTCACGGCCATCATCATCTTCGGCTCCTTCTACTACCCT
ATCATGGGCGTTCAGAGCACGCCACGCCAGGGTTTGGTCCTACTCTTCGTCCTCCAGCTGCTGATATACTGCTCC
GCCTTCGCCGACATGACCGTCGTGACGATGCCAGACGCCCACACGGCCGGCAGCCTGGCCACCGTCCTGGTCCTC
ATGAGCATCTTATTCTGCGGCGTCCTGCAGTCGCCCATAGCCATGCCAGGCTTCTGGATCTTCATGTACTGGCTT
TCTCCTTTTACCTATTGGGTCTCCGGCATCATCTCGACCGAGCTGCACGACCAGCCCATCAGCTGTACCAGGACG
GAGGAGTCCACCTTTGACCCTCCGTCGGGCATGTCGTGCGGCCAATACTTGCAGCCATTTCTGCAGGGCGGTGCC
CCCGGACATCTGGATAACCCGGACGCCCTTTCGCAGTGTCAATACTGCGCATACTCTACAGCCGACCAGTTACTA
GCAGGCTCCTGGATTTACTGGAATGATCGTTGGCGAAACTACGGCATTTTCTGGGCCTATATTGTCTTTGACATC
CTTATCGTTGTCCTGGTCTATTACCTATTTCGCGTCAAGCAATGGAGCGGCACCTTTTCCCGCGTTGCGAAACTT
GTGCCGAAACTGCGAAATCCAGTCGAGGAGGTCAAGGAGGAGTCGATGGCACCCCCCGAATCATCATCGCCCGGG
AATGACGACAAGGCAGTAAACCCTACTGGG
Transcript >Ophio5|8288
ATGGCCGTCTTCGGTCTCAGCCACACATACCACACCAAGGTCGGCAGCGACTTCGTCCGAGGCGTTTCCGGCGGC
GAGCGGAAACGCGTCAGTATCGCCGAGATGGTCGTGGCGGGATCGCCGCTGGCCTCGTGGGATAACAGCACCCGC
GGTCTCGACTCGGCTACGGCCTTCAAATTCGTCCAGTCTCTCCGTATGACGTGTGATCTCGCGTCACAGACCAAC
CTGGTAGCCATCTATCAAGCCAGCCAAGCCATCTACGACCTCTTCGACAAGGCCACCGTTCTATACGAGGGCCGT
CAGATCTTCTTCGGCCCAGCCAATCGCGCGCACCGCTTCTTCGAGGAACAAGGCTGGTATTGTCCTCCGCGTCAG
ACGACAGGCGACTTCCTGACGTCTGTGACGAACCCTTCGGAGCGACGAGCGCGGGCCGGAATGGAGGATCGCGTG
CCCCGGACGGCGGCAGAGTTTGAGGCCTACTGGAGAGAATCGGCAGACCATCAGGCGCTTCTGCGTGAGCTGGAT
GAATACGACGACGGCCAGCACCCCGGCGAGACCATCGCCCAGTTCCGTCGGCAGACAGAGGCCATTCGGGCAAAA
CACCGCGTACGGAGACATTCGCCCTACATCATCAGCGTCGGGCTGCAGATCGGACTCAACGTCAAGCGGGCTTAC
CAGCGGATCAGGGGCGATATGACTGCCAAGGTGGCCCAGACCCTGGCCGACATCTTCATGGCCCTCATCATCGGC
TCTCTCTTTTACAATACGCCCGACGCCACTGTCGGCTTCTATCCCAAGGGAGCGGTCCTGTTCATGGCCGTGTTG
ATGAACGCCTTGACGGCCATCTCCGAGATCAGCGGGTTGTACGAGCAGCGGCCGATTGTCGAGAAGCAACGGTCA
TATGCCTTCTATCATCCGGCCACCGAGGCTTTCGCCGGCTTGGTTGCCGATATCCCCATCAAGTTTGTCACCTCG
GCTGCTTTCAACCTGATAGTCTACTTTCTAGCGAACCTGCACCGGTCTCCGGGCCAGTTCTTCCTCTACTACCTC
ATCATCTTCATGACCATCTTCATCATGAGCGCCATCTTCCGCACCCTCGCCGCCGCCACCAAGACCATCTCCCAG
GCCATGGCCTTTGCGGGCGTCATGGCCTTGGCCCTCATCATGTACACGGGCTTCGCCATCCGGATCCCACAGATG
CATCCCTGGTGGATCAACCCCATCTTCTATGCCTTTGAGATCCTCATCGCCAACGAATTCCACGGCCACCAATAC
ACCTGCTCGAGCATCGTTCCCAACTACTCCCCTCCGGTCGGGAACTCGTTTACCTGCAGCGTGCCCGGCGCCGTT
GCCGGCCAGTTCACCGTCAGTGGCGACAGCTTCATCAAGGCCGACTACGACTACTCCTGGAGCCACGTGTGGAGA
AACTTTGGCATCCTCTGCGGCTTTCTCATCGGTTTCATCCTCATCTACCTCTTGACCATCGAGCTCAACTCGTCC
ACCACCAGCACAGCCGAGGCCCTCGTCTTCCCGCGTCGTCACGTTCCCGCTCATTTCAAACACGGTGACCAGGAG
GAGAAGATGGAGAAAGGTGCGGCCTCGACGGGCGCAGTCGTCCAGCGGTCCGACGACGACGACAACGACGACGAG
GGGTCCGAGATTCGCGCCCTGCCGGCTCAGACGGACATCTTCACCTGGCGTCGGGTCGTGTATGATATAGAGATC
AAGGGCAAGGGGCGTAGACTGCTCAACCACGTCGATGGCTGGGTCAAGCCCGGCACTCTGACGGCTCTCATGGGC
GTTTCAGGCGCGGGAAAGACGACGCTTCTCGACGTGCTCGCCCATAGAACCACCATGGGTGTCATCACCGGCGAC
ATGTTGGTCAACGGCAAGCCCTTGGATGCGAGCTTCCAGCGGAAGACGGGCTACGTTCAGCAGCAAGGTATTACC
ATCATGACTTGGAGGGAGATAAACAAAGGCGCAAAAAAAGGGGGCAGGAAGGGAGACACTGACACGTTGGACACT
ACAGATCTGCACTTGGCGACGGCCACGGTTCGAGAGAGCCTCCGATTCAGTGCCCTTCTTCGCCAACCCGACACA
ATCAGCAGAAAGGAAAAGTACGAGTTCGTTGAGGACATCATTAAGATGCTCAACATGGAGGAATTCTCCAACGCC
GTCGTCGGCATACCCGGAGAAGGCCTCAACGTAGAGCAACGCAAACTGCTGACCATCGGCGTCGAGCTGGCGGCC
AAGCCGAAACTCCTCCTCTTCCTGGACGAGCCGACCAGCGGTCTCGACTCACAAAGCTCATGGGCCATCTGCTCG
CTCCTGCGAAAGCTGGCCGACGGTGGTCAAGCCATCCTCTGCACCGTCCATCAGCCAAGCGCCATCCTCTTCCAG
TCTTTCGACCGCCTTCTCTTCCTCGCCAGGGGGGGAATGACGGTCTACTTTGGTGATATCGGGGAGAATTCACGC
ACGCTGCTTGATTATTTCGAGGCTCATGGCTCTCGTTTGTGCGGCGACGCTGAGAACCCGGCTGAGTTTATGCTC
GAGGTGGTGAATGACGGCCATAATGATGCGGGAGAGGATTGGCACACAATCTGGAAGTCCAGTCGCGAGTTTCAG
CATGTTCAGGAGGAGCTGGATAAGATGCATGCCGAGAGCGTCACCGAAGCATCCGACGCGGAGCCCGTCGACGGC
CGTCAGCTCGCCGAGTTCGCCGTCCCGCTTACGTCCCAGTTCGTCGAGGTCTTTTGGCGCTTGCTTCAGCAGTAC
TGGAGGATGCCGAGTTACGTGTTTGCCAAGTTGTTGCTCGGCGCCTTTGCTGGCCTCTTCATTGGCTTTACCTTT
TTCCATGCCAAGAAGACGCTGGCTGGGGTCCAGGAAGTCATCTACGCCGTCTTTACCCTCCTGACTGTGTTTACA
ACGCTCGTTCAGCAGCGAGCGCTGTACGAAGTCCGCGAACGACCCAGCAAGGCATATTCATGGAAAGCCTTTATT
GCTGCCAACATCTCAGTCGAGATACCCTTTCAGGTTCTCACGGCCATCATCATCTTCGGCTCCTTCTACTACCCT
ATCATGGGCGTTCAGAGCACGCCACGCCAGGGTTTGGTCCTACTCTTCGTCCTCCAGCTGCTGATATACTGCTCC
GCCTTCGCCGACATGACCGTCGTGACGATGCCAGACGCCCACACGGCCGGCAGCCTGGCCACCGTCCTGGTCCTC
ATGAGCATCTTATTCTGCGGCGTCCTGCAGTCGCCCATAGCCATGCCAGGCTTCTGGATCTTCATGTACTGGCTT
TCTCCTTTTACCTATTGGGTCTCCGGCATCATCTCGACCGAGCTGCACGACCAGCCCATCAGCTGTACCAGGACG
GAGGAGTCCACCTTTGACCCTCCGTCGGGCATGTCGTGCGGCCAATACTTGCAGCCATTTCTGCAGGGCGGTGCC
CCCGGACATCTGGATAACCCGGACGCCCTTTCGCAGTGTCAATACTGCGCATACTCTACAGCCGACCAGTTACTA
GCAGGCTCCTGGATTTACTGGAATGATCGTTGGCGAAACTACGGCATTTTCTGGGCCTATATTGTCTTTGACATC
CTTATCGTTGTCCTGGTCTATTACCTATTTCGCGTCAAGCAATGGAGCGGCACCTTTTCCCGCGTTGCGAAACTT
GTGCCGAAACTGCGAAATCCAGTCGAGGAGGTCAAGGAGGAGTCGATGGCACCCCCCGAATCATCATCGCCCGGG
AATGACGACAAGGCAGTAAACCCTACTGGGTAG
Gene >Ophio5|8288
ATGGCCGTCTTCGGTCTCAGCCACACATACCACACCAAGGTCGGCAGCGACTTCGTCCGAGGCGTTTCCGGCGGC
GAGCGGAAACGCGTCAGTATCGCCGAGATGGTCGTGGCGGGATCGCCGCTGGCCTCGTGGGATAACAGGTAAAGC
CTTTCCCCCCNNNNNNNNNNNNNCCCCTTTTTTTCCTCAAAAAAAAAAAACCATGACGGTTCCTTTAGCTGACTT
GAAGCAGCACCCGCGGTCTCGACTCGGCTACGGCCTTCAAATTCGTCCAGTCTCTCCGTATGACGTGTGATCTCG
CGTCACAGACCAACCTGGTAGCCATCTATCAAGCCAGCCAAGCCATCTACGACCTCTTCGACAAGGCCACCGTTC
TATACGAGGGCCGTCAGATCTTCTTCGGCCCAGCCAATCGCGCGCACCGCTTCTTCGAGGAACAAGGCTGGTATT
GTCCTCCGCGTCAGACGACAGGCGACTTCCTGACGTCTGTGACGAACCCTTCGGAGCGACGAGCGCGGGCCGGAA
TGGAGGATCGCGTGCCCCGGACGGCGGCAGAGTTTGAGGCCTACTGGAGAGAATCGGCAGACCATCAGGCGCTTC
TGCGTGAGCTGGATGAATACGACGACGGCCAGCACCCCGGCGAGACCATCGCCCAGTTCCGTCGGCAGACAGAGG
CCATTCGGGCAAAACACCGCGTACGGAGACATTCGCCCTACATCATCAGCGTCGGGCTGCAGATCGGACTCAACG
TCAAGCGGGCTTACCAGCGGATCAGGGGCGATATGACTGCCAAGGTGGCCCAGACCCTGGCCGACATCTTCATGG
CCCTCATCATCGGCTCTCTCTTTTACAATACGCCCGACGCCACTGTCGGCTTCTATCCCAAGGGAGCGGTCCTGT
TCATGGCCGTGTTGATGAACGCCTTGACGGCCATCTCCGAGATCAGCGGGTTGTACGAGCAGCGGCCGATTGTCG
AGAAGCAACGGTCATATGCCTTCTATCATCCGGCCACCGAGGCTTTCGCCGGCTTGGTTGCCGATATCCCCATCA
AGTTTGTCACCTCGGCTGCTTTCAACCTGATAGTCTACTTTCTAGCGAACCTGCACCGGTCTCCGGGCCAGTTCT
TCCTCTACTACCTCATCATCTTCATGACCATCTTCATCATGAGCGCCATCTTCCGCACCCTCGCCGCCGCCACCA
AGACCATCTCCCAGGCCATGGCCTTTGCGGGCGTCATGGCCTTGGCCCTCATCATGTACACGGGCTTCGCCATCC
GGATCCCACAGATGCATCCCTGGTAAGGCCTCTTCCGTCTCGTTTGCCCAGGGCGGTTTCTATGCTGACACCCCC
CCCCCCCCCCTGTGCAGGCTATCGTGGATTAGGTGGATCAACCCCATCTTCTATGCCTTTGAGATCCTCATCGCC
AACGAATTCCACGGCCACCAATACACCTGCTCGAGCATCGTTCCCAACTACTCCCCTCCGGTCGGGAACTCGTTT
ACCTGCAGCGTGCCCGGCGCCGTTGCCGGCCAGTTCACCGTCAGTGGCGACAGCTTCATCAAGGCCGACTACGAC
TACTCCTGGAGCCACGTGTGGAGAAACTTTGGCATCCTCTGCGGCTTTCTCATCGGTTTCATCCTCATCTACCTC
TTGACCATCGAGCTCAACTCGTCCACCACCAGCACAGCCGAGGCCCTCGTCTTCCCGCGTCGTCACGTTCCCGCT
CATTTCAAACACGGTGACCAGGAGGAGAAGATGGAGAAAGGTGCGGCCTCGACGGGCGCAGTCGTCCAGCGGTCC
GACGACGACGACAACGACGACGAGGGGTCCGAGATTCGCGCCCTGCCGGCTCAGACGGACATCTTCACCTGGCGT
CGGGTCGTGTATGATATAGAGATCAAGGGCAAGGGGCGTAGACTGCTCAACCACGTCGATGGCTGGGTCAAGCCC
GGCACTCTGACGGCTCTCATGGGCGTTTCAGGCGCGGGAAAGACGACGCTTCTCGACGTGCTCGCCCATAGAACC
ACCATGGGTGTCATCACCGGCGACATGTTGGTCAACGGCAAGCCCTTGGATGCGAGCTTCCAGCGGAAGACGGGC
TACGTTCAGCAGCAAGGTATTACCATCATGACTTGGAGGGAGATAAACAAAGGCGCAAAAAAAGGGGGCAGGAAG
GGAGACACTGACACGTTGGACACTACAGATCTGCACTTGGCGACGGCCACGGTTCGAGAGAGCCTCCGATTCAGT
GCCCTTCTTCGCCAACCCGACACAATCAGCAGAAAGGAAAAGTACGAGTTCGTTGAGGACATCATTAAGATGCTC
AACATGGAGGAATTCTCCAACGCCGTCGTCGGCATACCCGGAGAAGGCCTCAACGTAGAGCAACGCAAACTGCTG
ACCATCGGCGTCGAGCTGGCGGCCAAGCCGAAACTCCTCCTCTTCCTGGACGAGCCGACCAGCGGTCTCGACTCA
CAAAGCTCATGGGCCATCTGCTCGCTCCTGCGAAAGCTGGCCGACGGTGGTCAAGCCATCCTCTGCACCGTCCAT
CAGCCAAGCGCCATCCTCTTCCAGTCTTTCGACCGCCTTCTCTTCCTCGCCAGGGGGGGAATGACGGTCTACTTT
GGTGATATCGGGGAGAATTCACGCACGCTGCTTGATTATTTCGAGGCTCATGGCTCTCGTTTGTGCGGCGACGCT
GAGAACCCGGCTGAGTTTATGCTCGAGGTGGTGAATGACGGCCATAATGATGCGGGAGAGGATTGGCACACAATC
TGGAAGTCCAGTCGCGAGTTTCAGCATGTTCAGGAGGAGCTGGATAAGATGCATGCCGAGAGCGTCACCGAAGCA
TCCGACGCGGAGCCCGTCGACGGCCGTCAGCTCGCCGAGTTCGCCGTCCCGCTTACGTCCCAGTTCGTCGAGGTC
TTTTGGCGCTTGCTTCAGCAGTACTGGAGGATGCCGAGTTACGTGTTTGCCAAGTTGTTGCTCGGCGCCTTTGCT
GGCCTCTTCATTGGCTTTACCTTTTTCCATGCCAAGAAGACGCTGGCTGGGGTCCAGGAAGTCATCTACGCCGTC
TTTACCCTCCTGACTGTGTTTACAACGCTCGTTCAGCAGGTATGTTTGGTCCCCCCCCCCCCCCNNNNNNNNCCC
CCCCTTTTTTTTTTCCTGCGCTTCCTCCTTCATGGAGGAGAACTAACGACCAAGGGGGGACCAGATCCATCCTCA
TTTTGTCACCCAGCGAGCGCTGTACGAAGTCCGCGAACGACCCAGCAAGGCATATTCATGGAAAGCCTTTATTGC
TGCCAACATCTCAGTCGAGATACCCTTTCAGGTTCTCACGGCCATCATCATCTTCGGCTCCTTCTACTACCCTAT
CATGGGCGTTCAGAGCACGCCACGCCAGGGTTTGGTCCTACTCTTCGTCCTCCAGCTGCTGATATACTGCTCCGC
CTTCGCCGACATGACCGTCGTGACGATGCCAGACGCCCACACGGCCGGCAGCCTGGCCACCGTCCTGGTCCTCAT
GAGCATCTTATTCTGCGGCGTCCTGCAGTCGCCCATAGCCATGCCAGGCTTCTGGATCTTCATGTACTGGCTTTC
TCCTTTTACCTATTGGGTCTCCGGCATCATCTCGACCGAGCTGCACGACCAGCCCATCAGCTGTACCAGGACGGA
GGAGTCCACCTTTGACCCTCCGTCGGGCATGTCGTGCGGCCAATACTTGCAGCCATTTCTGCAGGGCGGTGCCCC
CGGACATCTGGATAACCCGGACGCCCTTTCGCAGTGTCAATACTGCGCATACTCTACAGCCGACCAGTTACTAGC
AGGCTCCTGGATTTACTGGAATGATCGTTGGCGAAACTACGGCATTTTCTGGGCCTATATTGTCTTTGACATCCT
TATCGTTGTCCTGGTCTATTACCTATTTCGCGTCAAGCAATGGAGCGGCACCTTTTCCCGCGTTGCGAAACTTGT
GCCGAAACTGCGAAATCCAGTCGAGGAGGTCAAGGAGGAGTCGATGGCACCCCCCGAATCATCATCGCCCGGGAA
TGACGACAAGGCAGTAAACCCTACTGGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail