Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8287
Gene name
Locationscaffold_9:91724..93489
Strand-
Gene length (bp)1765
Transcript length (bp)1707
Coding sequence length (bp)1704
Protein length (aa) 568

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.5E-24 126 484
PF00083 Sugar_tr Sugar (and other) transporter 1.4E-16 113 329

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P36035|JEN1_YEAST Carboxylic acid transporter protein homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=JEN1 PE=1 SV=1 102 539 5.0E-64
sp|O51798|MMLH_CUPPJ Probable 4-methylmuconolactone transporter OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=mmlH PE=3 SV=1 125 554 1.0E-17
sp|A8AQB4|NANT_CITK8 Putative sialic acid transporter OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=nanT PE=3 SV=1 125 496 9.0E-13
sp|A9MNY7|NANT_SALAR Putative sialic acid transporter OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=nanT PE=3 SV=1 125 496 8.0E-12
sp|B5F7J8|NANT_SALA4 Putative sialic acid transporter OS=Salmonella agona (strain SL483) GN=nanT PE=3 SV=1 125 496 1.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P36035|JEN1_YEAST Carboxylic acid transporter protein homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=JEN1 PE=1 SV=1 102 539 5.0E-64
sp|O51798|MMLH_CUPPJ Probable 4-methylmuconolactone transporter OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=mmlH PE=3 SV=1 125 554 1.0E-17
sp|A8AQB4|NANT_CITK8 Putative sialic acid transporter OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=nanT PE=3 SV=1 125 496 9.0E-13
sp|A9MNY7|NANT_SALAR Putative sialic acid transporter OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=nanT PE=3 SV=1 125 496 8.0E-12
sp|B5F7J8|NANT_SALA4 Putative sialic acid transporter OS=Salmonella agona (strain SL483) GN=nanT PE=3 SV=1 125 496 1.0E-11
sp|B4T749|NANT_SALNS Putative sialic acid transporter OS=Salmonella newport (strain SL254) GN=nanT PE=3 SV=1 125 496 2.0E-11
sp|B5FIR7|NANT_SALDC Putative sialic acid transporter OS=Salmonella dublin (strain CT_02021853) GN=nanT PE=3 SV=1 125 496 2.0E-11
sp|B5R0L1|NANT_SALEP Putative sialic acid transporter OS=Salmonella enteritidis PT4 (strain P125109) GN=nanT PE=3 SV=1 125 496 2.0E-11
sp|B5RET6|NANT_SALG2 Putative sialic acid transporter OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=nanT PE=3 SV=1 125 496 2.0E-11
sp|A9N832|NANT_SALPB Putative sialic acid transporter OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=nanT PE=3 SV=1 125 496 2.0E-11
sp|P0A2G6|NANT_SALTI Putative sialic acid transporter OS=Salmonella typhi GN=nanT PE=3 SV=1 125 496 2.0E-11
sp|P0A2G5|NANT_SALTY Putative sialic acid transporter OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=nanT PE=3 SV=1 125 496 2.0E-11
sp|Q8FDU9|NANT2_ECOL6 Putative sialic acid transporter 2 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=nanT2 PE=3 SV=1 109 497 2.0E-11
sp|Q5PLF0|NANT_SALPA Putative sialic acid transporter OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=nanT PE=3 SV=1 125 496 2.0E-11
sp|B5BGP4|NANT_SALPK Putative sialic acid transporter OS=Salmonella paratyphi A (strain AKU_12601) GN=nanT PE=3 SV=1 125 496 2.0E-11
sp|B4TJR2|NANT_SALHS Putative sialic acid transporter OS=Salmonella heidelberg (strain SL476) GN=nanT PE=3 SV=1 125 496 2.0E-11
sp|B4TWI9|NANT_SALSV Putative sialic acid transporter OS=Salmonella schwarzengrund (strain CVM19633) GN=nanT PE=3 SV=1 125 496 2.0E-11
sp|B1JFW5|NANT_YERPY Putative sialic acid transporter OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=nanT PE=3 SV=1 102 425 2.0E-11
sp|C0PZN3|NANT_SALPC Putative sialic acid transporter OS=Salmonella paratyphi C (strain RKS4594) GN=nanT PE=3 SV=1 125 496 3.0E-11
sp|Q57JD0|NANT_SALCH Putative sialic acid transporter OS=Salmonella choleraesuis (strain SC-B67) GN=nanT PE=3 SV=1 125 496 3.0E-11
sp|A4TMJ0|NANT_YERPP Putative sialic acid transporter OS=Yersinia pestis (strain Pestoides F) GN=nanT PE=3 SV=1 102 425 4.0E-11
sp|Q8FD59|NANT1_ECOL6 Putative sialic acid transporter 1 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=nanT1 PE=3 SV=2 125 496 4.0E-11
sp|A7MJD1|NANT_CROS8 Putative sialic acid transporter OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=nanT PE=3 SV=1 125 496 4.0E-11
sp|A7FG99|NANT_YERP3 Putative sialic acid transporter OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=nanT PE=3 SV=1 102 425 4.0E-11
sp|B2K942|NANT_YERPB Putative sialic acid transporter OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=nanT PE=3 SV=1 102 425 4.0E-11
sp|A9QZJ2|NANT_YERPG Putative sialic acid transporter OS=Yersinia pestis bv. Antiqua (strain Angola) GN=nanT PE=3 SV=1 102 425 4.0E-11
sp|Q668K2|NANT_YERPS Putative sialic acid transporter OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=nanT PE=3 SV=1 102 425 4.0E-11
sp|B7LRJ2|NANT_ESCF3 Putative sialic acid transporter OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=nanT PE=3 SV=1 125 496 4.0E-11
sp|A7ZSB7|NANT_ECO24 Putative sialic acid transporter OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=nanT PE=3 SV=1 125 496 4.0E-11
sp|B7UJV7|NANT_ECO27 Putative sialic acid transporter OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=nanT PE=3 SV=1 125 496 4.0E-11
sp|B7NKT5|NANT_ECO7I Putative sialic acid transporter OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=nanT PE=3 SV=1 125 496 4.0E-11
sp|B6I1U2|NANT_ECOSE Putative sialic acid transporter OS=Escherichia coli (strain SE11) GN=nanT PE=3 SV=1 125 496 4.0E-11
sp|B1LGI9|NANT_ECOSM Putative sialic acid transporter OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=nanT PE=3 SV=1 125 496 4.0E-11
sp|Q0TCP2|NANT_ECOL5 Putative sialic acid transporter OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=nanT PE=3 SV=1 125 496 4.0E-11
sp|Q1C5V2|NANT_YERPA Putative sialic acid transporter OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=nanT PE=3 SV=1 102 481 6.0E-11
sp|Q8ZCH3|NANT_YERPE Putative sialic acid transporter OS=Yersinia pestis GN=nanT PE=3 SV=1 102 481 6.0E-11
sp|A8A534|NANT_ECOHS Putative sialic acid transporter OS=Escherichia coli O9:H4 (strain HS) GN=nanT PE=3 SV=1 125 496 7.0E-11
sp|B7MBY6|NANT_ECO45 Putative sialic acid transporter OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=nanT PE=3 SV=1 125 496 8.0E-11
sp|P41036|NANT_ECOLI Putative sialic acid transporter OS=Escherichia coli (strain K12) GN=nanT PE=1 SV=2 125 496 2.0E-10
sp|B7LHS8|NANT_ECO55 Putative sialic acid transporter OS=Escherichia coli (strain 55989 / EAEC) GN=nanT PE=3 SV=1 125 496 2.0E-10
sp|B7M0T6|NANT_ECO8A Putative sialic acid transporter OS=Escherichia coli O8 (strain IAI1) GN=nanT PE=3 SV=1 125 496 2.0E-10
sp|B1IQQ5|NANT_ECOLC Putative sialic acid transporter OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=nanT PE=3 SV=1 125 496 2.0E-10
sp|B2U1W0|NANT_SHIB3 Putative sialic acid transporter OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=nanT PE=3 SV=1 125 496 2.0E-10
sp|Q0T066|NANT_SHIF8 Putative sialic acid transporter OS=Shigella flexneri serotype 5b (strain 8401) GN=nanT PE=3 SV=1 125 496 2.0E-10
sp|P59699|NANT_SHIFL Putative sialic acid transporter OS=Shigella flexneri GN=nanT PE=3 SV=1 125 496 2.0E-10
sp|C4ZSW2|NANT_ECOBW Putative sialic acid transporter OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=nanT PE=3 SV=1 125 496 2.0E-10
sp|B1XHJ7|NANT_ECODH Putative sialic acid transporter OS=Escherichia coli (strain K12 / DH10B) GN=nanT PE=3 SV=1 125 496 2.0E-10
sp|Q8X9G8|NANT_ECO57 Putative sialic acid transporter OS=Escherichia coli O157:H7 GN=nanT PE=3 SV=2 125 496 2.0E-10
sp|B5YSV1|NANT_ECO5E Putative sialic acid transporter OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=nanT PE=3 SV=1 125 496 2.0E-10
sp|P39352|YJHB_ECOLI Putative metabolite transport protein YjhB OS=Escherichia coli (strain K12) GN=yjhB PE=1 SV=2 124 486 3.0E-10
sp|Q43975|PCAK_ACIAD 4-hydroxybenzoate transporter PcaK OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=pcaK PE=1 SV=3 108 326 8.0E-07
sp|P77589|MHPT_ECOLI 3-(3-hydroxy-phenyl)propionate transporter OS=Escherichia coli (strain K12) GN=mhpT PE=1 SV=2 167 481 1.0E-06
sp|P71369|Y1104_HAEIN Putative metabolite transport protein HI_1104 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1104 PE=3 SV=1 128 479 4.0E-06
sp|P40862|PROP_SALTY Proline/betaine transporter OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=proP PE=3 SV=2 161 497 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.45

Transmembrane Domains

Domain # Start End Length
1 115 137 22
2 152 174 22
3 207 229 22
4 291 310 19
5 346 363 17
6 383 405 22
7 412 431 19
8 509 531 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8287
MYAASPASSQPPTSPRQSKAIDLDFVTRLKTSIPSQSPPPAPPPEPEPTMSAPRPDEPADDLAQGVVATARQSWQ
DLFTLRQRIVLSTPPSCAWRHAAPIGNPIRLLAQLSARGWLFFLVGLGAWMADAFDFHALSVQTVKLAGNYGRTK
TDVTLAITLTLLLRSVGAAAFGLAGDRWGRKWPMVVNMLVLGVLQVATIHCAEYPQFLAVRSLFGLFMGGVYGNA
IAMALEQCPSLAPVSNQQPRMDADQIYRNQARGLLSGILQQGYSLGYILAAGANLGVGGSQSSWKTVFWIGAGFS
IAIGLIRILLPESQQFLQAKQHDRDRKSAGDFWRSVKAMMRKEWKMSVYCVLLMTWFNYYSHASQDSYTTFMLMQ
KQLDNGGASRASMLMKTGACVGGCILGHISQALGRRRTIIMATLASALMIPAWILPSGERALSTTGFFMQFFVQG
AWGVIPIHLNELSPEQFRATFPGVVYQLGNMMASPAAQIVNALAERTFITVGHGHRVEAYGPVMGIATAVVAVGI
IVTVVLGPERHGRSFGLGSGEAEEESAEADEVKGGMTVREELR
Coding >Ophio5|8287
ATGTATGCAGCCAGTCCAGCCAGCAGCCAACCACCTACCTCCCCCAGACAGTCCAAAGCCATAGACCTTGACTTC
GTGACTCGTCTAAAGACCTCGATCCCCAGCCAGTCTCCTCCGCCAGCACCCCCCCCTGAACCAGAGCCAACAATG
TCGGCTCCTCGCCCGGACGAACCAGCCGACGACCTAGCCCAAGGCGTCGTTGCCACGGCCCGACAATCCTGGCAG
GACCTCTTCACCTTACGACAACGCATCGTCCTATCCACCCCGCCCTCCTGCGCCTGGCGACATGCCGCACCGATC
GGCAACCCGATCCGGCTATTGGCTCAACTCTCGGCACGCGGGTGGCTCTTCTTCCTCGTCGGCCTCGGCGCCTGG
ATGGCAGACGCTTTCGACTTCCACGCCTTGTCGGTGCAGACGGTCAAGTTGGCCGGAAACTATGGCCGGACCAAG
ACGGATGTCACGCTGGCTATCACCTTGACCCTGTTGTTGAGGAGTGTCGGCGCCGCCGCCTTTGGTCTCGCGGGA
GATCGATGGGGGCGCAAGTGGCCGATGGTGGTCAACATGCTGGTCCTGGGTGTGCTGCAGGTGGCCACCATTCAT
TGCGCAGAGTATCCGCAGTTTCTGGCCGTTCGCAGTCTGTTTGGCTTGTTCATGGGGGGCGTTTACGGGAATGCC
ATTGCCATGGCCCTGGAGCAGTGCCCGTCTCTGGCCCCTGTGTCGAATCAACAGCCACGCATGGATGCTGACCAG
ATATACAGAAACCAAGCCCGCGGCCTCCTTTCCGGCATCTTGCAGCAGGGCTACTCACTCGGCTACATCCTGGCA
GCCGGGGCCAACCTCGGCGTCGGAGGCAGCCAGAGCAGCTGGAAGACGGTCTTCTGGATCGGCGCCGGCTTCTCC
ATCGCCATCGGCCTCATCCGCATCCTGCTCCCCGAGTCGCAGCAATTCCTCCAAGCCAAGCAGCATGACCGCGAC
CGGAAATCAGCAGGCGACTTCTGGCGTTCCGTAAAGGCCATGATGCGAAAAGAGTGGAAGATGAGCGTCTACTGC
GTGCTGCTGATGACATGGTTCAACTACTACTCGCACGCATCGCAAGACTCATACACGACATTCATGCTGATGCAG
AAGCAGCTCGACAACGGGGGCGCGTCTCGCGCGTCCATGCTCATGAAGACGGGCGCCTGCGTTGGCGGCTGCATC
CTCGGCCACATCAGCCAAGCACTCGGCCGACGACGGACCATCATCATGGCGACGCTGGCATCAGCGCTGATGATT
CCGGCATGGATTCTGCCTTCGGGCGAGCGCGCCCTGAGCACGACCGGTTTCTTCATGCAGTTCTTCGTACAGGGC
GCCTGGGGCGTCATCCCCATTCACCTCAACGAGCTGTCACCTGAGCAGTTCCGGGCAACCTTCCCGGGCGTGGTG
TATCAGCTGGGAAACATGATGGCATCTCCCGCGGCGCAGATTGTAAATGCCCTGGCGGAGCGAACCTTTATCACC
GTTGGGCATGGCCACAGGGTCGAGGCGTACGGACCGGTTATGGGTATCGCGACGGCCGTCGTCGCCGTTGGCATC
ATCGTCACCGTCGTTCTCGGACCGGAGAGACATGGGCGAAGCTTCGGGCTGGGTTCGGGAGAGGCGGAAGAGGAG
TCGGCAGAGGCCGATGAGGTTAAGGGAGGCATGACGGTGAGGGAGGAGTTGAGG
Transcript >Ophio5|8287
ATGTATGCAGCCAGTCCAGCCAGCAGCCAACCACCTACCTCCCCCAGACAGTCCAAAGCCATAGACCTTGACTTC
GTGACTCGTCTAAAGACCTCGATCCCCAGCCAGTCTCCTCCGCCAGCACCCCCCCCTGAACCAGAGCCAACAATG
TCGGCTCCTCGCCCGGACGAACCAGCCGACGACCTAGCCCAAGGCGTCGTTGCCACGGCCCGACAATCCTGGCAG
GACCTCTTCACCTTACGACAACGCATCGTCCTATCCACCCCGCCCTCCTGCGCCTGGCGACATGCCGCACCGATC
GGCAACCCGATCCGGCTATTGGCTCAACTCTCGGCACGCGGGTGGCTCTTCTTCCTCGTCGGCCTCGGCGCCTGG
ATGGCAGACGCTTTCGACTTCCACGCCTTGTCGGTGCAGACGGTCAAGTTGGCCGGAAACTATGGCCGGACCAAG
ACGGATGTCACGCTGGCTATCACCTTGACCCTGTTGTTGAGGAGTGTCGGCGCCGCCGCCTTTGGTCTCGCGGGA
GATCGATGGGGGCGCAAGTGGCCGATGGTGGTCAACATGCTGGTCCTGGGTGTGCTGCAGGTGGCCACCATTCAT
TGCGCAGAGTATCCGCAGTTTCTGGCCGTTCGCAGTCTGTTTGGCTTGTTCATGGGGGGCGTTTACGGGAATGCC
ATTGCCATGGCCCTGGAGCAGTGCCCGTCTCTGGCCCCTGTGTCGAATCAACAGCCACGCATGGATGCTGACCAG
ATATACAGAAACCAAGCCCGCGGCCTCCTTTCCGGCATCTTGCAGCAGGGCTACTCACTCGGCTACATCCTGGCA
GCCGGGGCCAACCTCGGCGTCGGAGGCAGCCAGAGCAGCTGGAAGACGGTCTTCTGGATCGGCGCCGGCTTCTCC
ATCGCCATCGGCCTCATCCGCATCCTGCTCCCCGAGTCGCAGCAATTCCTCCAAGCCAAGCAGCATGACCGCGAC
CGGAAATCAGCAGGCGACTTCTGGCGTTCCGTAAAGGCCATGATGCGAAAAGAGTGGAAGATGAGCGTCTACTGC
GTGCTGCTGATGACATGGTTCAACTACTACTCGCACGCATCGCAAGACTCATACACGACATTCATGCTGATGCAG
AAGCAGCTCGACAACGGGGGCGCGTCTCGCGCGTCCATGCTCATGAAGACGGGCGCCTGCGTTGGCGGCTGCATC
CTCGGCCACATCAGCCAAGCACTCGGCCGACGACGGACCATCATCATGGCGACGCTGGCATCAGCGCTGATGATT
CCGGCATGGATTCTGCCTTCGGGCGAGCGCGCCCTGAGCACGACCGGTTTCTTCATGCAGTTCTTCGTACAGGGC
GCCTGGGGCGTCATCCCCATTCACCTCAACGAGCTGTCACCTGAGCAGTTCCGGGCAACCTTCCCGGGCGTGGTG
TATCAGCTGGGAAACATGATGGCATCTCCCGCGGCGCAGATTGTAAATGCCCTGGCGGAGCGAACCTTTATCACC
GTTGGGCATGGCCACAGGGTCGAGGCGTACGGACCGGTTATGGGTATCGCGACGGCCGTCGTCGCCGTTGGCATC
ATCGTCACCGTCGTTCTCGGACCGGAGAGACATGGGCGAAGCTTCGGGCTGGGTTCGGGAGAGGCGGAAGAGGAG
TCGGCAGAGGCCGATGAGGTTAAGGGAGGCATGACGGTGAGGGAGGAGTTGAGGTAG
Gene >Ophio5|8287
ATGTATGCAGCCAGTCCAGCCAGCAGCCAACCACCTACCTCCCCCAGACAGTCCAAAGCCATAGACCTTGACTTC
GTGACTCGTCTAAAGACCTCGATCCCCAGCCAGTCTCCTCCGCCAGCACCCCCCCCTGAACCAGAGCCAACAATG
TCGGCTCCTCGCCCGGACGAACCAGCCGACGACCTAGCCCAAGGCGTCGTTGCCACGGCCCGACAATCCTGGCAG
GACCTCTTCACCTTACGACAACGCATCGTCCTATCCACCCCGCCCTCCTGCGCCTGGCGACATGCCGCACCGATC
GGCAACCCGATCCGGCTATTGGCTCAACTCTCGGCACGCGGGTGGCTCTTCTTCCTCGTCGGCCTCGGCGCCTGG
ATGGCAGACGCTTTCGACTTCCACGCCTTGTCGGTGCAGACGGTCAAGTTGGCCGGAAACTATGGCCGGACCAAG
ACGGATGTCACGCTGGCTATCACCTTGACCCTGTTGTTGAGGAGTGTCGGCGCCGCCGCCTTTGGTCTCGCGGGA
GATCGATGGGGGCGCAAGTGGCCGATGGTGGTCAACATGCTGGTCCTGGGTGTGCTGCAGGTGGCCACCATTCAT
TGCGCAGAGTATCCGCAGTTTCTGGCCGTTCGCAGTCTGTTTGGCTTGTTCATGGGGGGCGTTTACGGGAATGCC
ATTGCCATGGCCCTGGAGCAGTGCCCGTCTCTGGCCCCTGTGTCGAATCAACAGCCACGCATGGATGCTGACCAG
ATATACAGAAACCAAGCCCGCGGCCTCCTTTCCGGCATCTTGCAGCAGGGCTACTCACTCGGCTACATCCTGGCA
GCCGGGGCCAACCTCGGCGTCGGAGGCAGCCAGAGCAGCTGGAAGACGGTCTTCTGGATCGGCGGTTCGCGCTCC
TCCCAAGACGAGACGAGTCGGCAAAAAATGCACTGACCAGTCCGCAGCCGGCTTCTCCATCGCCATCGGCCTCAT
CCGCATCCTGCTCCCCGAGTCGCAGCAATTCCTCCAAGCCAAGCAGCATGACCGCGACCGGAAATCAGCAGGCGA
CTTCTGGCGTTCCGTAAAGGCCATGATGCGAAAAGAGTGGAAGATGAGCGTCTACTGCGTGCTGCTGATGACATG
GTTCAACTACTACTCGCACGCATCGCAAGACTCATACACGACATTCATGCTGATGCAGAAGCAGCTCGACAACGG
GGGCGCGTCTCGCGCGTCCATGCTCATGAAGACGGGCGCCTGCGTTGGCGGCTGCATCCTCGGCCACATCAGCCA
AGCACTCGGCCGACGACGGACCATCATCATGGCGACGCTGGCATCAGCGCTGATGATTCCGGCATGGATTCTGCC
TTCGGGCGAGCGCGCCCTGAGCACGACCGGTTTCTTCATGCAGTTCTTCGTACAGGGCGCCTGGGGCGTCATCCC
CATTCACCTCAACGAGCTGTCACCTGAGCAGTTCCGGGCAACCTTCCCGGGCGTGGTGTATCAGCTGGGAAACAT
GATGGCATCTCCCGCGGCGCAGATTGTAAATGCCCTGGCGGAGCGAACCTTTATCACCGTTGGGCATGGCCACAG
GGTCGAGGCGTACGGACCGGTTATGGGTATCGCGACGGCCGTCGTCGCCGTTGGCATCATCGTCACCGTCGTTCT
CGGACCGGAGAGACATGGGCGAAGCTTCGGGCTGGGTTCGGGAGAGGCGGAAGAGGAGTCGGCAGAGGCCGATGA
GGTTAAGGGAGGCATGACGGTGAGGGAGGAGTTGAGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail