Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8261
Gene name
Locationscaffold_9:40051..43965
Strand+
Gene length (bp)3914
Transcript length (bp)3723
Coding sequence length (bp)3720
Protein length (aa) 1240

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16212 PhoLip_ATPase_C Phospholipid-translocating P-type ATPase C-terminal 9.5E-47 1039 1229
PF16209 PhoLip_ATPase_N Phospholipid-translocating ATPase N-terminal 1.7E-15 158 208
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 2.0E-07 603 915
PF13246 Cation_ATPase Cation transport ATPase (P-type) 4.3E-05 690 800

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40527|ATC7_YEAST Probable phospholipid-transporting ATPase NEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NEO1 PE=1 SV=1 160 1239 0.0E+00
sp|F1Q4S1|ATP9B_DANRE Probable phospholipid-transporting ATPase IIB OS=Danio rerio GN=atp9b PE=3 SV=1 148 1240 0.0E+00
sp|Q10309|YD56_SCHPO Putative phospholipid-transporting ATPase C6C3.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6C3.06c PE=3 SV=1 146 1239 0.0E+00
sp|A1A4J6|ATP9B_BOVIN Probable phospholipid-transporting ATPase IIB OS=Bos taurus GN=ATP9B PE=2 SV=1 148 1240 0.0E+00
sp|P98195|ATP9B_MOUSE Probable phospholipid-transporting ATPase IIB OS=Mus musculus GN=Atp9b PE=1 SV=4 148 1240 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40527|ATC7_YEAST Probable phospholipid-transporting ATPase NEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NEO1 PE=1 SV=1 160 1239 0.0E+00
sp|F1Q4S1|ATP9B_DANRE Probable phospholipid-transporting ATPase IIB OS=Danio rerio GN=atp9b PE=3 SV=1 148 1240 0.0E+00
sp|Q10309|YD56_SCHPO Putative phospholipid-transporting ATPase C6C3.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6C3.06c PE=3 SV=1 146 1239 0.0E+00
sp|A1A4J6|ATP9B_BOVIN Probable phospholipid-transporting ATPase IIB OS=Bos taurus GN=ATP9B PE=2 SV=1 148 1240 0.0E+00
sp|P98195|ATP9B_MOUSE Probable phospholipid-transporting ATPase IIB OS=Mus musculus GN=Atp9b PE=1 SV=4 148 1240 0.0E+00
sp|D4ABB8|ATP9B_RAT Probable phospholipid-transporting ATPase IIB OS=Rattus norvegicus GN=Atp9b PE=3 SV=1 148 1240 0.0E+00
sp|O43861|ATP9B_HUMAN Probable phospholipid-transporting ATPase IIB OS=Homo sapiens GN=ATP9B PE=2 SV=4 148 1240 0.0E+00
sp|O70228|ATP9A_MOUSE Probable phospholipid-transporting ATPase IIA OS=Mus musculus GN=Atp9a PE=1 SV=3 149 1240 0.0E+00
sp|O75110|ATP9A_HUMAN Probable phospholipid-transporting ATPase IIA OS=Homo sapiens GN=ATP9A PE=1 SV=3 149 1240 0.0E+00
sp|P98205|ALA2_ARATH Phospholipid-transporting ATPase 2 OS=Arabidopsis thaliana GN=ALA2 PE=1 SV=1 164 1225 7.0E-116
sp|P70704|AT8A1_MOUSE Phospholipid-transporting ATPase IA OS=Mus musculus GN=Atp8a1 PE=1 SV=2 144 1231 4.0E-112
sp|Q9Y2Q0|AT8A1_HUMAN Phospholipid-transporting ATPase IA OS=Homo sapiens GN=ATP8A1 PE=1 SV=1 144 1231 2.0E-111
sp|Q9U280|TAT1_CAEEL Phospholipid-transporting ATPase tat-1 OS=Caenorhabditis elegans GN=tat-1 PE=3 SV=3 157 1227 2.0E-111
sp|P98200|AT8A2_MOUSE Phospholipid-transporting ATPase IB OS=Mus musculus GN=Atp8a2 PE=1 SV=1 142 1228 8.0E-109
sp|Q5BL50|AT8B1_XENTR Phospholipid-transporting ATPase IC OS=Xenopus tropicalis GN=atp8b1 PE=2 SV=1 83 1220 6.0E-108
sp|Q9XIE6|ALA3_ARATH Phospholipid-transporting ATPase 3 OS=Arabidopsis thaliana GN=ALA3 PE=1 SV=2 120 1219 9.0E-107
sp|C7EXK4|AT8A2_BOVIN Phospholipid-transporting ATPase IB OS=Bos taurus GN=ATP8A2 PE=1 SV=4 148 1152 2.0E-106
sp|Q9NTI2|AT8A2_HUMAN Phospholipid-transporting ATPase IB OS=Homo sapiens GN=ATP8A2 PE=1 SV=2 142 1152 4.0E-106
sp|O94296|YOOC_SCHPO Probable phospholipid-transporting ATPase C887.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.12 PE=3 SV=1 138 1223 2.0E-105
sp|P98204|ALA1_ARATH Phospholipid-transporting ATPase 1 OS=Arabidopsis thaliana GN=ALA1 PE=2 SV=1 161 1229 1.0E-104
sp|P39524|ATC3_YEAST Probable phospholipid-transporting ATPase DRS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DRS2 PE=1 SV=2 161 1229 3.0E-104
sp|O36028|ATCZ_SCHPO Putative phospholipid-transporting ATPase C4F10.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4F10.16c PE=3 SV=1 144 1216 4.0E-104
sp|Q9LK90|ALA8_ARATH Probable phospholipid-transporting ATPase 8 OS=Arabidopsis thaliana GN=ALA8 PE=3 SV=1 161 1223 7.0E-103
sp|P57792|ALA12_ARATH Probable phospholipid-transporting ATPase 12 OS=Arabidopsis thaliana GN=ALA12 PE=2 SV=1 115 1223 9.0E-103
sp|P98198|AT8B2_HUMAN Phospholipid-transporting ATPase ID OS=Homo sapiens GN=ATP8B2 PE=1 SV=2 156 1231 5.0E-102
sp|Q9Y2G3|AT11B_HUMAN Probable phospholipid-transporting ATPase IF OS=Homo sapiens GN=ATP11B PE=1 SV=2 146 1226 2.0E-101
sp|P98199|AT8B2_MOUSE Phospholipid-transporting ATPase ID OS=Mus musculus GN=Atp8b2 PE=2 SV=2 156 1231 7.0E-101
sp|Q8TF62|AT8B4_HUMAN Probable phospholipid-transporting ATPase IM OS=Homo sapiens GN=ATP8B4 PE=1 SV=3 156 1227 2.0E-100
sp|Q9SLK6|ALA6_ARATH Phospholipid-transporting ATPase 6 OS=Arabidopsis thaliana GN=ALA6 PE=1 SV=2 155 1218 5.0E-100
sp|Q9SX33|ALA9_ARATH Putative phospholipid-transporting ATPase 9 OS=Arabidopsis thaliana GN=ALA9 PE=3 SV=1 117 1226 1.0E-99
sp|A3FIN4|AT8B5_MOUSE Phospholipid-transporting ATPase FetA OS=Mus musculus GN=Atp8b5 PE=2 SV=1 161 1165 1.0E-99
sp|P32660|ATC5_YEAST Phospholipid-transporting ATPase DNF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF1 PE=1 SV=2 155 1229 1.0E-97
sp|Q9SGG3|ALA5_ARATH Probable phospholipid-transporting ATPase 5 OS=Arabidopsis thaliana GN=ALA5 PE=3 SV=1 136 1165 1.0E-97
sp|P98196|AT11A_HUMAN Probable phospholipid-transporting ATPase IH OS=Homo sapiens GN=ATP11A PE=1 SV=3 142 1227 4.0E-97
sp|Q9LNQ4|ALA4_ARATH Probable phospholipid-transporting ATPase 4 OS=Arabidopsis thaliana GN=ALA4 PE=3 SV=2 134 1220 7.0E-97
sp|Q148W0|AT8B1_MOUSE Phospholipid-transporting ATPase IC OS=Mus musculus GN=Atp8b1 PE=1 SV=2 157 1220 8.0E-97
sp|Q29449|AT8A1_BOVIN Probable phospholipid-transporting ATPase IA OS=Bos taurus GN=ATP8A1 PE=1 SV=2 363 1155 2.0E-96
sp|Q9LI83|ALA10_ARATH Phospholipid-transporting ATPase 10 OS=Arabidopsis thaliana GN=ALA10 PE=3 SV=1 155 1222 3.0E-96
sp|P98197|AT11A_MOUSE Probable phospholipid-transporting ATPase IH OS=Mus musculus GN=Atp11a PE=1 SV=1 148 1227 3.0E-96
sp|Q9N0Z4|AT11B_RABIT Probable phospholipid-transporting ATPase IF (Fragment) OS=Oryctolagus cuniculus GN=ATP11B PE=1 SV=2 160 1238 1.0E-95
sp|O43520|AT8B1_HUMAN Phospholipid-transporting ATPase IC OS=Homo sapiens GN=ATP8B1 PE=1 SV=3 157 1220 4.0E-95
sp|Q9SAF5|ALA11_ARATH Probable phospholipid-transporting ATPase 11 OS=Arabidopsis thaliana GN=ALA11 PE=2 SV=1 161 1222 8.0E-95
sp|Q09891|ATCX_SCHPO Putative phospholipid-transporting ATPase C24B11.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24B11.12c PE=3 SV=1 137 1197 1.0E-91
sp|Q9QZW0|AT11C_MOUSE Phospholipid-transporting ATPase 11C OS=Mus musculus GN=Atp11c PE=1 SV=2 147 1227 1.0E-87
sp|Q8NB49|AT11C_HUMAN Phospholipid-transporting ATPase IG OS=Homo sapiens GN=ATP11C PE=1 SV=3 148 1227 6.0E-87
sp|Q6UQ17|AT8B3_MOUSE Phospholipid-transporting ATPase IK OS=Mus musculus GN=Atp8b3 PE=1 SV=1 160 1233 2.0E-86
sp|Q12675|ATC4_YEAST Phospholipid-transporting ATPase DNF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF2 PE=1 SV=1 137 1161 8.0E-85
sp|Q9LVK9|ALA7_ARATH Probable phospholipid-transporting ATPase 7 OS=Arabidopsis thaliana GN=ALA7 PE=3 SV=3 688 1223 4.0E-72
sp|Q9GKS6|AT10D_MACFA Probable phospholipid-transporting ATPase VD (Fragment) OS=Macaca fascicularis GN=ATP10D PE=2 SV=1 708 1161 4.0E-67
sp|O94823|AT10B_HUMAN Probable phospholipid-transporting ATPase VB OS=Homo sapiens GN=ATP10B PE=2 SV=2 709 1218 3.0E-65
sp|Q9P241|AT10D_HUMAN Probable phospholipid-transporting ATPase VD OS=Homo sapiens GN=ATP10D PE=2 SV=3 709 1219 1.0E-63
sp|Q8K2X1|AT10D_MOUSE Probable phospholipid-transporting ATPase VD OS=Mus musculus GN=Atp10d PE=2 SV=2 709 1161 6.0E-61
sp|O54827|AT10A_MOUSE Probable phospholipid-transporting ATPase VA OS=Mus musculus GN=Atp10a PE=1 SV=4 709 1224 2.0E-60
sp|O60312|AT10A_HUMAN Probable phospholipid-transporting ATPase VA OS=Homo sapiens GN=ATP10A PE=2 SV=2 709 1218 6.0E-60
sp|Q12674|ATC8_YEAST Probable phospholipid-transporting ATPase DNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF3 PE=1 SV=1 817 1239 2.0E-54
sp|O60423|AT8B3_HUMAN Phospholipid-transporting ATPase IK OS=Homo sapiens GN=ATP8B3 PE=2 SV=4 152 971 3.0E-53
sp|Q9UT43|YFRD_SCHPO Putative phospholipid-transporting ATPase C821.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC821.13c PE=1 SV=2 812 1218 5.0E-47
sp|Q12674|ATC8_YEAST Probable phospholipid-transporting ATPase DNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF3 PE=1 SV=1 164 665 2.0E-35
sp|Q9UT43|YFRD_SCHPO Putative phospholipid-transporting ATPase C821.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC821.13c PE=1 SV=2 312 800 1.0E-29
sp|O60423|AT8B3_HUMAN Phospholipid-transporting ATPase IK OS=Homo sapiens GN=ATP8B3 PE=2 SV=4 972 1219 2.0E-29
sp|Q9LVK9|ALA7_ARATH Probable phospholipid-transporting ATPase 7 OS=Arabidopsis thaliana GN=ALA7 PE=3 SV=3 156 633 9.0E-28
sp|O94823|AT10B_HUMAN Probable phospholipid-transporting ATPase VB OS=Homo sapiens GN=ATP10B PE=2 SV=2 160 632 1.0E-24
sp|O54827|AT10A_MOUSE Probable phospholipid-transporting ATPase VA OS=Mus musculus GN=Atp10a PE=1 SV=4 164 633 5.0E-23
sp|O60312|AT10A_HUMAN Probable phospholipid-transporting ATPase VA OS=Homo sapiens GN=ATP10A PE=2 SV=2 158 633 4.0E-22
sp|Q9P241|AT10D_HUMAN Probable phospholipid-transporting ATPase VD OS=Homo sapiens GN=ATP10D PE=2 SV=3 164 632 1.0E-19
sp|Q9LF79|ACA8_ARATH Calcium-transporting ATPase 8, plasma membrane-type OS=Arabidopsis thaliana GN=ACA8 PE=1 SV=1 587 1072 2.0E-19
sp|Q8K2X1|AT10D_MOUSE Probable phospholipid-transporting ATPase VD OS=Mus musculus GN=Atp10d PE=2 SV=2 160 632 9.0E-18
sp|O64806|ACA7_ARATH Putative calcium-transporting ATPase 7, plasma membrane-type OS=Arabidopsis thaliana GN=ACA7 PE=3 SV=2 587 1240 2.0E-15
sp|Q9LU41|ACA9_ARATH Calcium-transporting ATPase 9, plasma membrane-type OS=Arabidopsis thaliana GN=ACA9 PE=2 SV=2 587 1088 5.0E-15
sp|Q9HDW7|ATC2_SCHPO Calcium-transporting ATPase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmc1 PE=3 SV=1 547 1161 8.0E-15
sp|Q9SZR1|ACA10_ARATH Calcium-transporting ATPase 10, plasma membrane-type OS=Arabidopsis thaliana GN=ACA10 PE=1 SV=2 587 1072 1.0E-14
sp|O81108|ACA2_ARATH Calcium-transporting ATPase 2, plasma membrane-type OS=Arabidopsis thaliana GN=ACA2 PE=1 SV=1 587 1240 2.0E-14
sp|P54678|ATC1_DICDI Calcium-transporting ATPase PAT1 OS=Dictyostelium discoideum GN=patA PE=2 SV=2 751 1072 2.0E-14
sp|O34431|ATCL_BACSU Calcium-transporting ATPase OS=Bacillus subtilis (strain 168) GN=yloB PE=1 SV=1 559 1074 2.0E-14
sp|P58165|AT2B2_OREMO Plasma membrane calcium-transporting ATPase 2 (Fragment) OS=Oreochromis mossambicus GN=atp2b2 PE=2 SV=1 498 1072 4.0E-14
sp|Q9CTG6|AT132_MOUSE Probable cation-transporting ATPase 13A2 OS=Mus musculus GN=Atp13a2 PE=2 SV=3 750 1044 2.0E-13
sp|Q08853|ATC_PLAFK Calcium-transporting ATPase OS=Plasmodium falciparum (isolate K1 / Thailand) GN=ATP6 PE=3 SV=1 755 1078 4.0E-13
sp|Q9NQ11|AT132_HUMAN Probable cation-transporting ATPase 13A2 OS=Homo sapiens GN=ATP13A2 PE=1 SV=2 599 1073 1.0E-12
sp|Q4VNC1|AT134_HUMAN Probable cation-transporting ATPase 13A4 OS=Homo sapiens GN=ATP13A4 PE=2 SV=3 743 1147 2.0E-12
sp|Q37145|ACA1_ARATH Calcium-transporting ATPase 1, chloroplastic OS=Arabidopsis thaliana GN=ACA1 PE=1 SV=3 508 1240 4.0E-12
sp|Q3TYU2|AT135_MOUSE Probable cation-transporting ATPase 13A5 OS=Mus musculus GN=Atp13a5 PE=2 SV=2 552 1079 4.0E-12
sp|Q29449|AT8A1_BOVIN Probable phospholipid-transporting ATPase IA OS=Bos taurus GN=ATP8A1 PE=1 SV=2 144 253 9.0E-12
sp|P22189|ATC3_SCHPO Calcium-transporting ATPase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cta3 PE=1 SV=1 508 1075 1.0E-11
sp|Q5XF90|AT134_MOUSE Probable cation-transporting ATPase 13A4 OS=Mus musculus GN=Atp13a4 PE=2 SV=1 754 1053 1.0E-11
sp|P20020|AT2B1_HUMAN Plasma membrane calcium-transporting ATPase 1 OS=Homo sapiens GN=ATP2B1 PE=1 SV=3 817 1072 2.0E-11
sp|P23220|AT2B1_PIG Plasma membrane calcium-transporting ATPase 1 OS=Sus scrofa GN=ATP2B1 PE=2 SV=1 817 1072 2.0E-11
sp|P11505|AT2B1_RAT Plasma membrane calcium-transporting ATPase 1 OS=Rattus norvegicus GN=Atp2b1 PE=1 SV=2 817 1072 2.0E-11
sp|G5E829|AT2B1_MOUSE Plasma membrane calcium-transporting ATPase 1 OS=Mus musculus GN=Atp2b1 PE=1 SV=1 817 1072 3.0E-11
sp|Q01896|ATN2_YEAST Sodium transport ATPase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENA2 PE=1 SV=1 508 1096 1.0E-10
sp|P13587|ATN1_YEAST Sodium transport ATPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENA1 PE=1 SV=1 508 1096 2.0E-10
sp|Q12691|ATN5_YEAST Sodium transport ATPase 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENA5 PE=1 SV=1 508 1096 2.0E-10
sp|Q00804|AT2B1_RABIT Plasma membrane calcium-transporting ATPase 1 OS=Oryctolagus cuniculus GN=ATP2B1 PE=2 SV=2 817 1072 5.0E-10
sp|P38929|ATC2_YEAST Calcium-transporting ATPase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMC1 PE=1 SV=1 753 1180 6.0E-10
sp|Q9LIK7|ACA13_ARATH Putative calcium-transporting ATPase 13, plasma membrane-type OS=Arabidopsis thaliana GN=ACA13 PE=3 SV=1 867 1072 5.0E-09
sp|Q9LT02|PDR2_ARATH Probable manganese-transporting ATPase PDR2 OS=Arabidopsis thaliana GN=PDR2 PE=1 SV=1 479 1033 6.0E-08
sp|Q5XF89|AT133_MOUSE Probable cation-transporting ATPase 13A3 OS=Mus musculus GN=Atp13a3 PE=1 SV=1 748 1044 9.0E-08
sp|P35315|ATC_TRYBB Probable calcium-transporting ATPase OS=Trypanosoma brucei brucei GN=TBA1 PE=3 SV=1 866 1083 1.0E-07
sp|O14072|ATC4_SCHPO Manganese-transporting ATPase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cta4 PE=3 SV=1 522 1031 2.0E-07
sp|Q21286|YBF7_CAEEL Probable cation-transporting ATPase K07E3.7 OS=Caenorhabditis elegans GN=K07E3.7/K07E3.6 PE=3 SV=4 754 1044 3.0E-07
sp|Q12674|ATC8_YEAST Probable phospholipid-transporting ATPase DNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF3 PE=1 SV=1 677 800 9.0E-07
sp|Q9H7F0|AT133_HUMAN Probable cation-transporting ATPase 13A3 OS=Homo sapiens GN=ATP13A3 PE=1 SV=4 751 1044 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

Domain # Start End Length
1 1150 1172 22
2 1181 1203 22
3 1207 1229 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8261
MPPSPSYRAPDSPTHDSDSDLDLDPDLDLDLDLHELDPVSAEPPSRRRPPEQRTPRIALRNLRMGSLRRAQKRGR
GYGHLGAPGDDSVDTDGFSSGNGDDDAPLLGGDQRAHPPRRESRVRLPGFMTAASRVHDHGPQDKPDDDASASRT
VVVGGSQAARFPANLVSNAKYTALTFLPLTLYNEFSFFFNMYFLLVALSQAIPALRIGYLSTYVAPLAFVLLITM
GKEAYDDIERRRRDTEANSEPYRVLTFGDPGSIASSLRPRRPLKSDTVRRGSRRSRRNDLSDIQEEDDVVEAPTP
SSHVQEVSRKSKDLRVGQVLKLNKGQRVPADVVILQCCTADGCASKEPAEEEALLAFAEGGQVSKGKKIAAEAVM
DEPETGTVGETFIRTDQLDGETDWKLRLASPLTQNLPPEEFVRLRVTGGKPDQRVNEFFGTLELLPPRQEASSSQ
GSENDEATKSWALSIDNTAWANTVIASQGTTLAVIMYTGPQTRSALSTAPSRSKTGLLEYEINSLTKILCALTLA
LSVVLVALQGFEKTGGNAWYIKIMRFLVLFSTIVPISLRVNLDLGKSAYSRFIQNDPGIPGAVVRTSTIPEDLGR
IEYLLSDKTGTLTKNDMEMKKIHVGTVSYANEAMDEVGAYVRQGFCSTTDASQMLATPSSTHPAAVNVGTSRTRR
DIASRVRDVVLALALCHNVTPTVDSEDGRQVTSYQASSPDEIAIVKWAESVGLRLASRDRKSMTLQSTESGRSVV
RVRILEVFPFTSDGKRMGIIVHFQEDANAPNADLGSGEIWFYQKGADTVMSSIVAANDWLDEETANMAREGLRTL
VVGRKKLSAQQYREFSSRHHEASLSISGRDAGLQAVVSRYLETDLELLGVTGVEDKLQRDVKPSLELLRNAGIKI
WMLTGDKVETARCVAVSSKLVARGQYIYTVARLKKKDSARDHLDFLRSKTDSCLLIDGESLALLLTHLRLEFITI
AVQLPTVVACRCSPTQKAEVAKLIKEFTKKRVCCIGDGGNDVSMIQAADVGVGIVGKEGRQASLAADFSIEQFCH
LVKLLVWHGRNSYKRSAKLAQFVIHRGLIIAVCQTMYSIALEFEPEGLYKDWLLVGYATIYTAAPVLSLVLDKDV
DENVANLYPELYKELTSGRSLSYRTFFVWVLVSIYQGGMIQGLSQLLTEVDGPKMVAVSYTVLVLNELIMVAIEI
TTWNPVMIISILGTFLVFAGSIPFLGGYFDLTFIITLGFL
Coding >Ophio5|8261
ATGCCTCCTTCACCTTCCTACCGAGCGCCGGATTCGCCAACGCACGACTCCGACTCAGACCTCGATCTCGACCCG
GACCTTGACCTCGACCTCGATCTTCACGAGCTCGATCCCGTCTCGGCCGAGCCGCCGTCCCGTCGTCGCCCGCCC
GAGCAGCGGACGCCGCGGATCGCGCTGCGAAACCTGCGCATGGGAAGCCTGCGTCGCGCCCAGAAGCGAGGCCGC
GGCTATGGCCATCTCGGTGCCCCTGGAGACGATTCGGTTGATACCGATGGCTTCAGCAGCGGAAACGGCGATGAC
GACGCTCCGCTGCTGGGCGGCGATCAACGGGCACATCCGCCTCGTCGCGAGTCCCGCGTTCGCCTGCCCGGCTTC
ATGACCGCCGCGAGCCGTGTACACGACCACGGGCCGCAAGATAAGCCGGACGATGACGCCTCGGCATCGAGGACC
GTTGTTGTTGGAGGAAGCCAGGCCGCGCGCTTCCCTGCCAACCTCGTGTCCAACGCGAAATACACGGCCCTGACC
TTTTTGCCCCTCACTCTATACAACGAATTCTCTTTTTTCTTCAACATGTACTTTCTGCTCGTCGCTCTCTCGCAG
GCTATCCCGGCTCTGCGCATCGGCTATCTGTCCACATACGTCGCTCCCTTGGCCTTTGTCCTGCTCATCACCATG
GGCAAGGAAGCCTATGACGACATCGAGCGGCGCAGGAGAGACACGGAAGCCAACTCGGAGCCCTACCGGGTCCTT
ACCTTTGGCGATCCCGGATCGATTGCCTCCTCGCTTCGACCGCGTCGGCCGCTCAAGTCCGACACCGTGAGGCGC
GGTTCTCGGAGGTCGAGAAGGAACGACCTCTCCGACATTCAAGAAGAGGACGATGTGGTCGAGGCGCCGACGCCC
TCTTCGCATGTCCAAGAAGTCAGCCGCAAATCCAAGGATCTCAGGGTCGGCCAGGTCCTGAAGCTAAACAAAGGG
CAGCGTGTGCCGGCCGATGTGGTCATCCTGCAGTGCTGCACCGCCGATGGCTGCGCGTCTAAGGAACCCGCAGAG
GAGGAAGCACTACTGGCTTTTGCCGAGGGTGGACAGGTCTCCAAGGGCAAGAAAATCGCAGCCGAGGCCGTTATG
GACGAGCCCGAGACCGGCACCGTCGGAGAGACGTTTATCAGGACGGACCAGCTCGACGGCGAGACGGACTGGAAG
CTGCGGCTAGCGAGCCCCTTAACGCAGAACCTGCCGCCCGAAGAGTTTGTCCGCCTTCGCGTGACGGGCGGAAAG
CCTGATCAAAGGGTGAATGAATTCTTTGGGACTCTGGAGCTACTACCGCCGCGCCAAGAGGCCTCGTCGAGCCAG
GGGAGCGAAAACGACGAGGCCACCAAGTCTTGGGCGCTGTCCATCGACAATACGGCTTGGGCCAACACCGTCATC
GCCTCGCAGGGCACGACTCTCGCCGTCATCATGTACACGGGTCCTCAGACACGCTCCGCCCTATCGACGGCACCG
TCGCGGTCCAAGACGGGGCTGCTGGAGTACGAGATCAATTCGCTGACCAAAATCCTGTGTGCCCTGACGCTGGCC
CTGTCCGTCGTGCTCGTCGCACTCCAGGGCTTCGAGAAGACGGGGGGCAACGCCTGGTACATCAAGATTATGCGC
TTCCTCGTCCTCTTCTCTACCATTGTACCCATTAGCCTGCGCGTGAACCTGGATCTGGGCAAGAGCGCGTATTCG
AGGTTCATCCAGAACGACCCCGGCATTCCCGGTGCAGTCGTCCGAACGAGTACGATCCCAGAAGATCTCGGGCGG
ATCGAATACCTACTCAGCGACAAGACGGGCACTCTCACGAAAAACGACATGGAGATGAAGAAGATTCACGTCGGC
ACCGTCTCGTACGCCAACGAGGCCATGGACGAGGTTGGCGCCTACGTCCGACAGGGCTTCTGCAGCACGACAGAC
GCTTCTCAGATGCTCGCCACGCCGTCTTCTACTCATCCGGCCGCCGTCAACGTCGGCACAAGCCGCACGAGGCGC
GATATCGCGTCTCGAGTGCGTGACGTCGTCCTGGCCCTGGCTCTTTGCCACAACGTCACGCCGACGGTCGACAGC
GAGGACGGCAGGCAGGTGACGTCGTATCAAGCGTCATCGCCGGACGAGATTGCCATCGTCAAATGGGCCGAGTCT
GTGGGGCTCAGGTTGGCCTCGCGCGATCGCAAGAGCATGACGCTGCAGTCGACGGAGAGCGGCCGGAGCGTAGTT
CGCGTCCGCATCCTTGAAGTATTCCCCTTTACCTCGGACGGCAAGCGGATGGGCATCATCGTCCACTTCCAGGAA
GACGCCAATGCGCCCAACGCCGACCTCGGCAGCGGCGAAATTTGGTTCTATCAAAAGGGGGCAGACACGGTCATG
AGCTCCATCGTGGCAGCAAATGATTGGCTGGACGAGGAAACGGCCAACATGGCGCGTGAGGGTCTGCGGACGCTC
GTCGTCGGTCGCAAGAAGCTCTCGGCTCAGCAGTATCGCGAGTTCTCGTCTCGTCACCACGAGGCCTCGCTCTCC
ATTTCCGGACGCGATGCTGGCCTGCAGGCCGTCGTCTCGCGCTACCTCGAGACGGATCTTGAGCTGCTCGGCGTG
ACGGGCGTCGAGGACAAGCTCCAGCGGGACGTCAAGCCGTCGCTGGAACTGCTGCGCAACGCCGGCATCAAGATC
TGGATGCTGACGGGCGACAAGGTCGAGACGGCGAGGTGCGTCGCTGTCAGCTCCAAGCTCGTCGCCAGGGGGCAG
TACATTTACACCGTGGCCCGTCTCAAGAAGAAGGATTCGGCGCGCGATCATCTGGATTTCCTGCGCAGCAAGACG
GATTCCTGTCTGCTCATCGACGGCGAGAGCCTGGCCCTCCTGCTCACGCATCTTCGACTGGAATTCATCACCATC
GCCGTCCAACTCCCCACGGTGGTGGCATGCCGCTGCTCCCCTACGCAAAAAGCCGAAGTGGCCAAGCTGATCAAG
GAGTTCACCAAGAAGCGCGTCTGCTGCATCGGCGACGGCGGAAACGATGTGTCCATGATCCAAGCCGCCGACGTC
GGTGTCGGCATCGTCGGCAAGGAAGGTCGTCAGGCCAGTCTGGCGGCCGACTTCTCCATCGAGCAGTTCTGCCAT
CTCGTCAAGCTACTCGTCTGGCACGGGCGAAATAGTTACAAGCGGAGCGCGAAGCTGGCGCAGTTTGTCATCCAT
CGTGGGCTCATCATTGCCGTCTGTCAAACCATGTATAGTATTGCCCTCGAGTTTGAGCCGGAGGGGCTTTACAAG
GATTGGCTTCTCGTTGGTTACGCTACGATTTACACGGCTGCTCCCGTTCTGTCCCTGGTTCTCGACAAGGACGTG
GATGAGAATGTGGCCAATCTCTATCCGGAGCTCTACAAGGAGCTCACGTCGGGACGCTCGCTGTCGTACCGCACC
TTCTTCGTCTGGGTTCTCGTCTCGATTTACCAGGGCGGCATGATCCAGGGCCTGTCGCAGCTGCTCACCGAGGTC
GATGGGCCCAAGATGGTGGCTGTCAGCTACACGGTGCTAGTGCTCAACGAGCTCATCATGGTGGCCATTGAGATT
ACGACATGGAATCCGGTCATGATCATCAGCATCCTCGGCACCTTTCTCGTCTTTGCTGGATCAATTCCTTTTTTG
GGGGGGTATTTCGATCTCACGTTTATCATTACATTGGGCTTCCTC
Transcript >Ophio5|8261
ATGCCTCCTTCACCTTCCTACCGAGCGCCGGATTCGCCAACGCACGACTCCGACTCAGACCTCGATCTCGACCCG
GACCTTGACCTCGACCTCGATCTTCACGAGCTCGATCCCGTCTCGGCCGAGCCGCCGTCCCGTCGTCGCCCGCCC
GAGCAGCGGACGCCGCGGATCGCGCTGCGAAACCTGCGCATGGGAAGCCTGCGTCGCGCCCAGAAGCGAGGCCGC
GGCTATGGCCATCTCGGTGCCCCTGGAGACGATTCGGTTGATACCGATGGCTTCAGCAGCGGAAACGGCGATGAC
GACGCTCCGCTGCTGGGCGGCGATCAACGGGCACATCCGCCTCGTCGCGAGTCCCGCGTTCGCCTGCCCGGCTTC
ATGACCGCCGCGAGCCGTGTACACGACCACGGGCCGCAAGATAAGCCGGACGATGACGCCTCGGCATCGAGGACC
GTTGTTGTTGGAGGAAGCCAGGCCGCGCGCTTCCCTGCCAACCTCGTGTCCAACGCGAAATACACGGCCCTGACC
TTTTTGCCCCTCACTCTATACAACGAATTCTCTTTTTTCTTCAACATGTACTTTCTGCTCGTCGCTCTCTCGCAG
GCTATCCCGGCTCTGCGCATCGGCTATCTGTCCACATACGTCGCTCCCTTGGCCTTTGTCCTGCTCATCACCATG
GGCAAGGAAGCCTATGACGACATCGAGCGGCGCAGGAGAGACACGGAAGCCAACTCGGAGCCCTACCGGGTCCTT
ACCTTTGGCGATCCCGGATCGATTGCCTCCTCGCTTCGACCGCGTCGGCCGCTCAAGTCCGACACCGTGAGGCGC
GGTTCTCGGAGGTCGAGAAGGAACGACCTCTCCGACATTCAAGAAGAGGACGATGTGGTCGAGGCGCCGACGCCC
TCTTCGCATGTCCAAGAAGTCAGCCGCAAATCCAAGGATCTCAGGGTCGGCCAGGTCCTGAAGCTAAACAAAGGG
CAGCGTGTGCCGGCCGATGTGGTCATCCTGCAGTGCTGCACCGCCGATGGCTGCGCGTCTAAGGAACCCGCAGAG
GAGGAAGCACTACTGGCTTTTGCCGAGGGTGGACAGGTCTCCAAGGGCAAGAAAATCGCAGCCGAGGCCGTTATG
GACGAGCCCGAGACCGGCACCGTCGGAGAGACGTTTATCAGGACGGACCAGCTCGACGGCGAGACGGACTGGAAG
CTGCGGCTAGCGAGCCCCTTAACGCAGAACCTGCCGCCCGAAGAGTTTGTCCGCCTTCGCGTGACGGGCGGAAAG
CCTGATCAAAGGGTGAATGAATTCTTTGGGACTCTGGAGCTACTACCGCCGCGCCAAGAGGCCTCGTCGAGCCAG
GGGAGCGAAAACGACGAGGCCACCAAGTCTTGGGCGCTGTCCATCGACAATACGGCTTGGGCCAACACCGTCATC
GCCTCGCAGGGCACGACTCTCGCCGTCATCATGTACACGGGTCCTCAGACACGCTCCGCCCTATCGACGGCACCG
TCGCGGTCCAAGACGGGGCTGCTGGAGTACGAGATCAATTCGCTGACCAAAATCCTGTGTGCCCTGACGCTGGCC
CTGTCCGTCGTGCTCGTCGCACTCCAGGGCTTCGAGAAGACGGGGGGCAACGCCTGGTACATCAAGATTATGCGC
TTCCTCGTCCTCTTCTCTACCATTGTACCCATTAGCCTGCGCGTGAACCTGGATCTGGGCAAGAGCGCGTATTCG
AGGTTCATCCAGAACGACCCCGGCATTCCCGGTGCAGTCGTCCGAACGAGTACGATCCCAGAAGATCTCGGGCGG
ATCGAATACCTACTCAGCGACAAGACGGGCACTCTCACGAAAAACGACATGGAGATGAAGAAGATTCACGTCGGC
ACCGTCTCGTACGCCAACGAGGCCATGGACGAGGTTGGCGCCTACGTCCGACAGGGCTTCTGCAGCACGACAGAC
GCTTCTCAGATGCTCGCCACGCCGTCTTCTACTCATCCGGCCGCCGTCAACGTCGGCACAAGCCGCACGAGGCGC
GATATCGCGTCTCGAGTGCGTGACGTCGTCCTGGCCCTGGCTCTTTGCCACAACGTCACGCCGACGGTCGACAGC
GAGGACGGCAGGCAGGTGACGTCGTATCAAGCGTCATCGCCGGACGAGATTGCCATCGTCAAATGGGCCGAGTCT
GTGGGGCTCAGGTTGGCCTCGCGCGATCGCAAGAGCATGACGCTGCAGTCGACGGAGAGCGGCCGGAGCGTAGTT
CGCGTCCGCATCCTTGAAGTATTCCCCTTTACCTCGGACGGCAAGCGGATGGGCATCATCGTCCACTTCCAGGAA
GACGCCAATGCGCCCAACGCCGACCTCGGCAGCGGCGAAATTTGGTTCTATCAAAAGGGGGCAGACACGGTCATG
AGCTCCATCGTGGCAGCAAATGATTGGCTGGACGAGGAAACGGCCAACATGGCGCGTGAGGGTCTGCGGACGCTC
GTCGTCGGTCGCAAGAAGCTCTCGGCTCAGCAGTATCGCGAGTTCTCGTCTCGTCACCACGAGGCCTCGCTCTCC
ATTTCCGGACGCGATGCTGGCCTGCAGGCCGTCGTCTCGCGCTACCTCGAGACGGATCTTGAGCTGCTCGGCGTG
ACGGGCGTCGAGGACAAGCTCCAGCGGGACGTCAAGCCGTCGCTGGAACTGCTGCGCAACGCCGGCATCAAGATC
TGGATGCTGACGGGCGACAAGGTCGAGACGGCGAGGTGCGTCGCTGTCAGCTCCAAGCTCGTCGCCAGGGGGCAG
TACATTTACACCGTGGCCCGTCTCAAGAAGAAGGATTCGGCGCGCGATCATCTGGATTTCCTGCGCAGCAAGACG
GATTCCTGTCTGCTCATCGACGGCGAGAGCCTGGCCCTCCTGCTCACGCATCTTCGACTGGAATTCATCACCATC
GCCGTCCAACTCCCCACGGTGGTGGCATGCCGCTGCTCCCCTACGCAAAAAGCCGAAGTGGCCAAGCTGATCAAG
GAGTTCACCAAGAAGCGCGTCTGCTGCATCGGCGACGGCGGAAACGATGTGTCCATGATCCAAGCCGCCGACGTC
GGTGTCGGCATCGTCGGCAAGGAAGGTCGTCAGGCCAGTCTGGCGGCCGACTTCTCCATCGAGCAGTTCTGCCAT
CTCGTCAAGCTACTCGTCTGGCACGGGCGAAATAGTTACAAGCGGAGCGCGAAGCTGGCGCAGTTTGTCATCCAT
CGTGGGCTCATCATTGCCGTCTGTCAAACCATGTATAGTATTGCCCTCGAGTTTGAGCCGGAGGGGCTTTACAAG
GATTGGCTTCTCGTTGGTTACGCTACGATTTACACGGCTGCTCCCGTTCTGTCCCTGGTTCTCGACAAGGACGTG
GATGAGAATGTGGCCAATCTCTATCCGGAGCTCTACAAGGAGCTCACGTCGGGACGCTCGCTGTCGTACCGCACC
TTCTTCGTCTGGGTTCTCGTCTCGATTTACCAGGGCGGCATGATCCAGGGCCTGTCGCAGCTGCTCACCGAGGTC
GATGGGCCCAAGATGGTGGCTGTCAGCTACACGGTGCTAGTGCTCAACGAGCTCATCATGGTGGCCATTGAGATT
ACGACATGGAATCCGGTCATGATCATCAGCATCCTCGGCACCTTTCTCGTCTTTGCTGGATCAATTCCTTTTTTG
GGGGGGTATTTCGATCTCACGTTTATCATTACATTGGGCTTCCTCTGA
Gene >Ophio5|8261
ATGCCTCCTTCACCTTCCTACCGAGCGCCGGATTCGCCAACGCACGACTCCGACTCAGACCTCGATCTCGACCCG
GACCTTGACCTCGACCTCGATCTTCACGAGCTCGATCCCGTCTCGGCCGAGCCGCCGTCCCGTCGTCGCCCGCCC
GAGCAGCGGACGCCGCGGATCGCGCTGCGAAACCTGCGCATGGGAAGCCTGCGTCGCGCCCAGAAGCGAGGCCGC
GGCTATGGCCATCTCGGTGCCCCTGGAGACGATTCGGTTGATACCGATGGCTTCAGCAGCGGAAACGGCGATGAC
GACGCTCCGCTGCTGGGCGGCGATCAACGGGCACATCCGCCTCGTCGCGAGTCCCGCGTTCGCCTGCCCGGCTTC
ATGACCGCCGCGAGCCGTGTACACGACCACGGGCCGCAAGATAAGCCGGACGATGACGCCTCGGCATCGAGGACC
GTTGTTGTTGGAGGAAGCCAGGCCGCGCGCTTCCCTGCCAACCTCGTGTCCAACGCGAAATACACGGCCCTGACC
TTTTTGCCCCTCACTCTATACAACGAATTCTCTTTTTTCTTCAACATGTACTTTCTGCTCGTCGCTCTCTCGCAG
GCTATCCCGGCTCTGCGCATCGGCTATCTGTCCACATACGTCGCTCCCTTGGCCTTTGTCCTGCTCATCACCATG
GGCAAGGAAGCCTATGACGACATCGAGCGGCGCAGGAGAGACACGGAAGCCAACTCGGAGCCCTACCGGGTCCTT
ACCTTTGGCGATCCCGGATCGATTGCCTCCTCGCTTCGACCGCGTCGGCCGCTCAAGTCCGACACCGTGAGGCGC
GGTTCTCGGAGGTCGAGAAGGAACGACCTCTCCGACATTCAAGAAGAGGACGATGTGGTCGAGGCGCCGACGCCC
TCTTCGCATGTCCAAGAAGTCAGCCGCAAATCCAAGGATCTCAGGGTCGGCCAGGTCCTGAAGCTAAACAAAGGG
CAGCGTGTGCCGGCCGATGTGGTCATCCTGCAGTGCTGCACCGCCGATGGCTGCGCGTCTAAGGAACCCGCAGAG
GAGGAAGCACTACTGGCTTTTGCCGAGGGTGGACAGGTCTCCAAGGGCAAGAAAATCGCAGCCGAGGCCGTTATG
GACGAGCCCGAGACCGGCACCGTCGGAGAGACGTTTATCAGGACGGACCAGCTCGACGGCGAGACGGACTGGAAG
CTGCGGCTAGCGAGCCCCTTAACGCAGAACCTGCCGCCCGAAGAGTTTGTCCGCCTTCGCGTGACGGGCGGAAAG
CCTGATCAAAGGGTGAATGAATTCTTTGGGACTCTGGAGCTACTACCGCCGCGCCAAGAGGCCTCGTCGAGCCAG
GGGAGCGAAAACGACGAGGCCACCAAGTCTTGGGCGCTGTCCATCGACAATACGGCTTGGGCCAACACCGTCATC
GCCTCGCAGGGCACGACTCTCGCCGTCATCATGTACACGGGTCCTCAGACACGCTCCGCCCTATCGACGGCACCG
TCGCGGTCCAAGACGGGGCTGCTGGAGTACGAGATCAATTCGCTGACCAAAATCCTGTGTGCCCTGACGCTGGCC
CTGTCCGTCGTGCTCGTCGCACTCCAGGGCTTCGAGAAGACGGGGGGCAACGCCTGGTACATCAAGATTATGCGC
TTCCTCGTCCTCTTCTCTACCATTGTACCCATTAGCCTGCGCGTGAACCTGGATCTGGGCAAGAGCGCGTATTCG
AGGTTCATCCAGAACGACCCCGGCATTCCCGGTGCAGTCGTCCGAACGAGTACGATCCCAGAAGATCTCGGGCGG
ATCGAATACCTACTCAGCGACAAGACGGGCACTCTCACGAAAAACGACATGGAGATGAAGAAGATTCACGTCGGC
ACCGTCTCGTACGCCAACGAGGCCATGGACGAGGTTGGCGCCTACGTCCGACAGGGCTTCTGCAGCACGACAGAC
GCTTCTCAGATGCTCGCCACGCCGTCTTCTACTCATCCGGCCGCCGTCAACGTCGGCACAAGCCGCACGAGGCGC
GATATCGCGTCTCGAGTGCGTGACGTCGTCCTGGCCCTGGCTCTTTGCCACAACGTCACGCCGACGGTCGACAGC
GAGGACGGCAGGCAGGTGACGTCGTATCAAGCGTCATCGCCGGACGAGATTGCCATCGTCAAATGGGCCGAGTCT
GTGGGGCTCAGGTTGGCCTCGCGCGATCGCAAGAGCATGACGCTGCAGTCGACGGAGAGCGGCCGGAGCGTAGTT
CGCGTCCGCATCCTTGAAGTATTCCCCTTTACCTCGGACGGCAAGCGGATGGGCATCATCGTCCACTTCCAGGAA
GACGCCAATGCGCCCAACGCCGACCTCGGCAGCGGCGAAATTTGGTTCTATCAAAAGGGGGCAGACACGGTCATG
AGCTCCATCGTGGCAGCAAATGATTGGCTGGACGAGGAAACGGCCAACATGGCGCGTGAGGGTCTGCGGACGCTC
GTCGTCGGTCGCAAGAAGCTCTCGGCTCAGCAGTATCGCGAGTTCTCGTCTCGTCACCACGAGGCCTCGCTCTCC
ATTTCCGGACGCGATGCTGGCCTGCAGGCCGTCGTCTCGCGCTACCTCGAGACGGATCTTGAGCTGCTCGGCGTG
ACGGGCGTCGAGGACAAGCTCCAGCGGGACGTCAAGCCGTCGCTGGAACTGCTGCGCAACGCCGGCATCAAGATC
TGGATGCTGACGGGCGACAAGGTCGAGACGGCGAGGTGCGTCGCTGTCAGCTCCAAGCTCGTCGCCAGGGGGCAG
TACATTTACACCGTGGCCCGTCTCAAGAAGAAGGATTCGGCGCGCGATCATCTGGATTTCCTGCGCAGCAAGACG
GATTCCTGTCTGCTCATCGACGGCGAGAGCCTGGCCCTCCTGCTCACGCATCTTCGACTGGAATTCATCACCATC
GCCGTCCAACTCCCCACGGTGGTGGCATGCCGCTGCTCCCCTACGCAAAAAGCCGAAGTGGCCAAGCTGATCAAG
GAGTTCACCAAGAAGCGCGTCTGCTGCATCGGCGACGGCGGAAACGATGTGTCCATGATCCAAGCCGCCGACGTC
GGTGTCGGCATCGTCGGCAAGGAAGGTCGTCAGGCCAGTCTGGCGGCCGACTTCTCCATCGAGCAGTTCTGCCAT
CTCGTCAAGCTACTCGTCTGGCACGGGCGAAATAGTTACAAGCGGAGCGCGAAGCTGGCGCAGTTTGTCATCCAT
CGTGGGCTCATCATTGCCGTCTGTCAAACCATGTATAGTATTGCCCTCGAGTTTGAGCCGGAGGGGCTTTACAAG
GTGAGCTTTTTTTTTTCTGACTCTCCTTCCCCTTTTTTTTGTAAGTGCCTTTGCCTGACTTGTTGTAAAGGATTG
GCTTCTCGTTGGTTACGCTACGATTTACACGGCTGCTCCCGTTCTGTCCCTGGTTCTCGACAAGGACGTGGATGA
GAATGTGGCCAATCTCTATCCGGAGCTCTACAAGGAGCTCACGTCGGGACGCTCGCTGTCGTACCGCACCTTCTT
CGTCTGGGTTCTCGTCTCGATTTACCAGGGCGGCATGATCCAGGGCCTGTCGCAGCTGCTCACCGAGGTCGATGG
GCCCAAGATGGTGGCTGTCAGCTACACGGTGCTAGTGCTCAACGAGCTCATCATGGTGGCCATTGAGATTACGAC
ATGGAATCCGGTCATGATCATCAGCATCCTCGGCACCTTTCTCGTCTTTGCTGGATCAATTCCTTTTTTGGGGGG
GTATTTCGATCTCACGTTTATCATTACATTGTCCGTCTCTTTCCCACTTTCTGTCTCGGCAACACATCCTACTGA
CACTTTTTGGGGGTCTTCCAGGGGCTTCCTGTGGCGCATCCTGGCCATCGGCGCCATCTCGCTCGTGCCACCCTA
TGCCGGCAAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail