Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|826
Gene name
Locationscaffold_124:571..1626
Strand-
Gene length (bp)1055
Transcript length (bp)996
Coding sequence length (bp)993
Protein length (aa) 331

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10357 Kin17_mid Domain of Kin17 curved DNA-binding protein 5.6E-53 52 177
PF12874 zf-met Zinc-finger of C2H2 type 2.6E-04 26 48

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7X9|KIN17_SCHPO KIN17-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC365.09c PE=3 SV=1 1 198 7.0E-74
sp|Q8K339|KIN17_MOUSE DNA/RNA-binding protein KIN17 OS=Mus musculus GN=Kin PE=1 SV=1 1 247 1.0E-66
sp|O60870|KIN17_HUMAN DNA/RNA-binding protein KIN17 OS=Homo sapiens GN=KIN PE=1 SV=2 1 180 1.0E-63
sp|Q55D16|KIN17_DICDI KIN17-like protein OS=Dictyostelium discoideum GN=DDB_G0269816 PE=3 SV=1 1 210 9.0E-51
sp|P40962|RTS2_YEAST Zinc finger protein RTS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RTS2 PE=1 SV=1 4 190 7.0E-35

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3282 0.9107 0.0247 0.0159 0.1391 0.0041 0.044 0.0043 0.0237 0.0012

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1113
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1835
Ophiocordyceps australis map64 (Brazil) OphauB2|7380
Ophiocordyceps camponoti-floridani Ophcf2|04791
Ophiocordyceps camponoti-rufipedis Ophun1|49
Ophiocordyceps kimflemingae Ophio5|826 (this protein)
Ophiocordyceps subramaniannii Hirsu2|10145

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|826
MPKAEVGSTKHLSNQLKSKGLQRLRWYCQVCEKQCRDANGFKMHTQSEGHVRQMLVVGEDPKKFINEYSHQFQRD
FLQLLKTGHGEKQVHINQFYQEYIANKEHIHMNATKWPSLTEFAKHLGRESICRVEETDKGIHISWIDNSPEALR
RQDALRRKQAQDQGDEQLEKRMLKEQIRRAQANVAKRQTEEEEDDDSRHLLRQDGEKIKLSFGPKKDTDGSDATT
INTPATEATAPTGSEISGEPKEKPGKPGIFGGLSMKMGGKPQPKNVFAQAKKKDALSAGAFKKTAVDDQPKKMSE
VERIMRDELERKRSRESAGFGGPPGKKHRST
Coding >Ophio5|826
ATGCCCAAGGCCGAGGTCGGCTCGACCAAACACCTTTCCAACCAGCTGAAAAGTAAAGGTCTTCAACGCCTGCGC
TGGTACTGCCAGGTGTGCGAGAAACAATGCAGGGATGCAAACGGTTTCAAGATGCACACCCAATCGGAGGGCCAC
GTACGGCAGATGCTTGTTGTCGGCGAGGACCCGAAGAAATTCATCAACGAGTACAGCCATCAGTTTCAGAGGGAC
TTTTTGCAGCTTCTGAAGACGGGCCATGGAGAGAAGCAGGTTCATATCAACCAATTCTATCAAGAGTACATCGCC
AACAAGGAGCACATCCACATGAACGCCACTAAATGGCCCTCCTTGACCGAGTTCGCCAAACACCTGGGACGAGAG
AGCATATGCCGCGTTGAAGAAACCGACAAGGGCATCCACATTTCGTGGATCGACAACTCCCCCGAGGCACTGCGA
CGGCAGGACGCGCTCCGCAGGAAGCAAGCTCAGGATCAGGGAGACGAGCAGCTCGAAAAGCGCATGTTAAAGGAG
CAGATCCGGAGAGCGCAAGCCAACGTCGCAAAGCGCCAGACGGAAGAAGAAGAAGACGATGACTCCCGACATCTC
CTAAGACAAGATGGTGAAAAGATCAAGCTGTCGTTTGGCCCGAAGAAGGATACAGATGGATCGGATGCCACGACC
ATCAACACCCCGGCCACTGAGGCCACTGCACCAACCGGGTCCGAGATAAGCGGCGAGCCAAAAGAGAAGCCTGGG
AAGCCTGGCATCTTTGGAGGGCTGTCGATGAAAATGGGTGGCAAGCCACAGCCGAAGAATGTTTTTGCGCAAGCG
AAGAAGAAGGACGCCCTCTCGGCCGGGGCGTTCAAAAAAACGGCCGTGGATGACCAGCCGAAGAAGATGAGCGAG
GTGGAAAGGATAATGCGGGATGAACTGGAGCGAAAACGGTCCAGAGAGTCAGCCGGGTTTGGCGGGCCCCCCGGG
AAGAAGCATCGAAGCACT
Transcript >Ophio5|826
ATGCCCAAGGCCGAGGTCGGCTCGACCAAACACCTTTCCAACCAGCTGAAAAGTAAAGGTCTTCAACGCCTGCGC
TGGTACTGCCAGGTGTGCGAGAAACAATGCAGGGATGCAAACGGTTTCAAGATGCACACCCAATCGGAGGGCCAC
GTACGGCAGATGCTTGTTGTCGGCGAGGACCCGAAGAAATTCATCAACGAGTACAGCCATCAGTTTCAGAGGGAC
TTTTTGCAGCTTCTGAAGACGGGCCATGGAGAGAAGCAGGTTCATATCAACCAATTCTATCAAGAGTACATCGCC
AACAAGGAGCACATCCACATGAACGCCACTAAATGGCCCTCCTTGACCGAGTTCGCCAAACACCTGGGACGAGAG
AGCATATGCCGCGTTGAAGAAACCGACAAGGGCATCCACATTTCGTGGATCGACAACTCCCCCGAGGCACTGCGA
CGGCAGGACGCGCTCCGCAGGAAGCAAGCTCAGGATCAGGGAGACGAGCAGCTCGAAAAGCGCATGTTAAAGGAG
CAGATCCGGAGAGCGCAAGCCAACGTCGCAAAGCGCCAGACGGAAGAAGAAGAAGACGATGACTCCCGACATCTC
CTAAGACAAGATGGTGAAAAGATCAAGCTGTCGTTTGGCCCGAAGAAGGATACAGATGGATCGGATGCCACGACC
ATCAACACCCCGGCCACTGAGGCCACTGCACCAACCGGGTCCGAGATAAGCGGCGAGCCAAAAGAGAAGCCTGGG
AAGCCTGGCATCTTTGGAGGGCTGTCGATGAAAATGGGTGGCAAGCCACAGCCGAAGAATGTTTTTGCGCAAGCG
AAGAAGAAGGACGCCCTCTCGGCCGGGGCGTTCAAAAAAACGGCCGTGGATGACCAGCCGAAGAAGATGAGCGAG
GTGGAAAGGATAATGCGGGATGAACTGGAGCGAAAACGGTCCAGAGAGTCAGCCGGGTTTGGCGGGCCCCCCGGG
AAGAAGCATCGAAGCACTTGA
Gene >Ophio5|826
ATGCCCAAGGCCGAGGTCGGCTCGACCAAACACCTTTCCAACCAGCTGAAAAGTAAAGGTCTTCAACGCCTGCGC
TGGTACTGCCAGGTGTGCGAGAAACAATGCAGGGATGCAAACGGTTTCAAGATGCACACCCAATCGGAGGGCCAC
GTACGGCAGATGCTTGTTGTCGGCGAGGACCCGAAGAAATTCATCAACGAGTACAGCCATCAGTTTCAGAGGGAC
TTTTTGCAGCTTCTGAAGACGGGCCATGGAGAGAAGCAGGTTCATATCAACCAATTCTATCAAGAGTACATCGCC
AACAAGGTATCCGACGCCTCCGCGCTTCCAGAAGCTCATTAGAACCCGTCGCTAATGGCACCTAGGAGCACATCC
ACATGAACGCCACTAAATGGCCCTCCTTGACCGAGTTCGCCAAACACCTGGGACGAGAGAGCATATGCCGCGTTG
AAGAAACCGACAAGGGCATCCACATTTCGTGGATCGACAACTCCCCCGAGGCACTGCGACGGCAGGACGCGCTCC
GCAGGAAGCAAGCTCAGGATCAGGGAGACGAGCAGCTCGAAAAGCGCATGTTAAAGGAGCAGATCCGGAGAGCGC
AAGCCAACGTCGCAAAGCGCCAGACGGAAGAAGAAGAAGACGATGACTCCCGACATCTCCTAAGACAAGATGGTG
AAAAGATCAAGCTGTCGTTTGGCCCGAAGAAGGATACAGATGGATCGGATGCCACGACCATCAACACCCCGGCCA
CTGAGGCCACTGCACCAACCGGGTCCGAGATAAGCGGCGAGCCAAAAGAGAAGCCTGGGAAGCCTGGCATCTTTG
GAGGGCTGTCGATGAAAATGGGTGGCAAGCCACAGCCGAAGAATGTTTTTGCGCAAGCGAAGAAGAAGGACGCCC
TCTCGGCCGGGGCGTTCAAAAAAACGGCCGTGGATGACCAGCCGAAGAAGATGAGCGAGGTGGAAAGGATAATGC
GGGATGAACTGGAGCGAAAACGGTCCAGAGAGTCAGCCGGGTTTGGCGGGCCCCCCGGGAAGAAGCATCGAAGCA
CTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail