Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|825
Gene name
Locationscaffold_1239:423..2102
Strand-
Gene length (bp)1679
Transcript length (bp)1557
Coding sequence length (bp)1554
Protein length (aa) 518

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20400 BAR_4 BAR-like domain 2.3E-33 94 275
PF20399 PH_20 PH domain 3.8E-20 295 375

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O94447|SLM1_SCHPO Cytoskeletal signaling protein slm1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=slm1 PE=1 SV=1 24 409 1.0E-46
sp|P53955|SLM2_YEAST Phosphatidylinositol 4,5-bisphosphate-binding protein SLM2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLM2 PE=1 SV=1 39 413 2.0E-16
sp|P40485|SLM1_YEAST Phosphatidylinositol 4,5-bisphosphate-binding protein SLM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLM1 PE=1 SV=1 39 415 1.0E-14
sp|Q06108|RGC1_YEAST Regulator of the glycerol channel 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RGC1 PE=1 SV=1 109 343 2.0E-12

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|825
MSGEPSPTSTLHSRVVTGLTSNNGGEAVPDEDPTTTAGLLAERLQAWKHAVSYLDEYMIVVEKIHGRQAKEYEKA
LKMISNPLRQGHHFDQSLGGIAGFFENVRANTQSLINTNLETEKSLKGSVLPILDRLHKEIKHKSKELQSGAQSG
AKELEKLRNATQKQIELLGQQTASYDSAGGRFHGHDDPYVVMRSVMHRLSNQVVAENNHHNDLVAVQGNFKTFEA
HIIAVLQQAVEAFVQLVGGQGEKTRALFSDMLGTVQAVPSDFEWVNFAHRCASRLANPADPPRSVDAIQFPNMDH
GSTKPLIEGSLERKSRNKLSWGLSTGYYVVTPARYLHEFKDSDDTRQDPKPELSIYLPDATIGAPHEDRFTVKGK
DRSKTLSSKLTGSSELSFKAHTPEDAMKWFQVIHAVSSSGAASSEPGSPAVDTSAAATTTTPTAGTTPTTPKTPT
TPMTPTTTTADEKRPVVDGGDDKKPIAEPADVVPGHKAQEAGVVGTALTTSTPTAAPVVEEKKSEAAA
Coding >Ophio5|825
ATGTCTGGCGAGCCCTCGCCCACGTCGACGCTGCACTCGCGCGTCGTCACGGGCCTCACCTCCAACAATGGAGGC
GAGGCTGTGCCCGACGAAGATCCGACGACGACGGCCGGTCTGCTCGCCGAGCGCCTTCAGGCCTGGAAGCACGCC
GTGTCCTACCTGGATGAGTACATGATCGTCGTCGAGAAGATTCACGGCCGCCAGGCCAAGGAGTACGAGAAGGCG
CTCAAGATGATATCCAACCCTTTGCGCCAGGGCCATCATTTCGATCAGAGCCTGGGCGGCATCGCCGGCTTCTTC
GAAAATGTGCGCGCCAACACGCAGTCCCTCATCAACACCAATCTCGAGACGGAAAAGAGCCTCAAGGGTTCCGTC
TTGCCTATCCTCGACCGCCTGCACAAGGAGATCAAGCACAAGTCCAAGGAGCTGCAAAGCGGCGCCCAGAGCGGC
GCAAAGGAGCTCGAGAAGCTGCGCAACGCAACCCAGAAGCAGATCGAGCTGCTGGGCCAGCAGACGGCCTCGTAC
GATTCGGCTGGCGGCCGCTTCCACGGCCACGACGACCCTTACGTGGTGATGCGCTCCGTCATGCACCGGCTGAGC
AACCAGGTCGTGGCCGAGAACAACCATCACAACGACCTGGTGGCCGTGCAGGGCAACTTCAAGACGTTCGAGGCG
CACATTATCGCCGTGCTCCAGCAGGCCGTCGAGGCCTTTGTTCAGCTCGTCGGCGGCCAGGGCGAGAAGACGCGC
GCCCTCTTCAGCGACATGCTCGGTACCGTCCAGGCCGTCCCCTCGGACTTTGAATGGGTCAACTTCGCCCACCGC
TGCGCCAGCAGGCTGGCCAACCCGGCCGATCCTCCTCGCTCCGTCGACGCCATCCAGTTCCCTAACATGGACCAC
GGCTCGACCAAGCCGCTGATAGAGGGCTCGCTCGAGCGCAAGTCGCGCAACAAGCTCTCGTGGGGCCTGTCGACG
GGCTACTACGTCGTCACCCCGGCCCGCTACCTGCACGAGTTCAAGGACTCGGACGACACGCGTCAGGATCCCAAG
CCCGAGCTGTCCATCTACCTTCCCGACGCCACCATCGGCGCCCCGCACGAGGACCGCTTCACCGTCAAGGGCAAG
GACCGCAGCAAGACGCTCAGCAGCAAACTGACGGGCAGCTCCGAGCTGTCCTTCAAGGCCCACACCCCGGAAGAC
GCCATGAAGTGGTTCCAGGTCATCCACGCCGTCAGCAGCTCCGGCGCCGCCTCCTCCGAACCCGGCTCGCCTGCC
GTCGATACCTCGGCGGCGGCGACGACGACGACTCCGACGGCCGGCACGACGCCGACGACGCCCAAGACTCCGACG
ACGCCCATGACGCCAACCACGACGACGGCCGACGAGAAGAGGCCGGTCGTCGACGGCGGCGACGACAAGAAGCCG
ATTGCCGAACCGGCCGATGTCGTCCCGGGCCACAAGGCGCAGGAGGCGGGCGTCGTCGGTACCGCCCTCACCACG
TCCACTCCTACTGCCGCTCCCGTCGTCGAGGAGAAGAAGAGTGAGGCTGCTGCG
Transcript >Ophio5|825
ATGTCTGGCGAGCCCTCGCCCACGTCGACGCTGCACTCGCGCGTCGTCACGGGCCTCACCTCCAACAATGGAGGC
GAGGCTGTGCCCGACGAAGATCCGACGACGACGGCCGGTCTGCTCGCCGAGCGCCTTCAGGCCTGGAAGCACGCC
GTGTCCTACCTGGATGAGTACATGATCGTCGTCGAGAAGATTCACGGCCGCCAGGCCAAGGAGTACGAGAAGGCG
CTCAAGATGATATCCAACCCTTTGCGCCAGGGCCATCATTTCGATCAGAGCCTGGGCGGCATCGCCGGCTTCTTC
GAAAATGTGCGCGCCAACACGCAGTCCCTCATCAACACCAATCTCGAGACGGAAAAGAGCCTCAAGGGTTCCGTC
TTGCCTATCCTCGACCGCCTGCACAAGGAGATCAAGCACAAGTCCAAGGAGCTGCAAAGCGGCGCCCAGAGCGGC
GCAAAGGAGCTCGAGAAGCTGCGCAACGCAACCCAGAAGCAGATCGAGCTGCTGGGCCAGCAGACGGCCTCGTAC
GATTCGGCTGGCGGCCGCTTCCACGGCCACGACGACCCTTACGTGGTGATGCGCTCCGTCATGCACCGGCTGAGC
AACCAGGTCGTGGCCGAGAACAACCATCACAACGACCTGGTGGCCGTGCAGGGCAACTTCAAGACGTTCGAGGCG
CACATTATCGCCGTGCTCCAGCAGGCCGTCGAGGCCTTTGTTCAGCTCGTCGGCGGCCAGGGCGAGAAGACGCGC
GCCCTCTTCAGCGACATGCTCGGTACCGTCCAGGCCGTCCCCTCGGACTTTGAATGGGTCAACTTCGCCCACCGC
TGCGCCAGCAGGCTGGCCAACCCGGCCGATCCTCCTCGCTCCGTCGACGCCATCCAGTTCCCTAACATGGACCAC
GGCTCGACCAAGCCGCTGATAGAGGGCTCGCTCGAGCGCAAGTCGCGCAACAAGCTCTCGTGGGGCCTGTCGACG
GGCTACTACGTCGTCACCCCGGCCCGCTACCTGCACGAGTTCAAGGACTCGGACGACACGCGTCAGGATCCCAAG
CCCGAGCTGTCCATCTACCTTCCCGACGCCACCATCGGCGCCCCGCACGAGGACCGCTTCACCGTCAAGGGCAAG
GACCGCAGCAAGACGCTCAGCAGCAAACTGACGGGCAGCTCCGAGCTGTCCTTCAAGGCCCACACCCCGGAAGAC
GCCATGAAGTGGTTCCAGGTCATCCACGCCGTCAGCAGCTCCGGCGCCGCCTCCTCCGAACCCGGCTCGCCTGCC
GTCGATACCTCGGCGGCGGCGACGACGACGACTCCGACGGCCGGCACGACGCCGACGACGCCCAAGACTCCGACG
ACGCCCATGACGCCAACCACGACGACGGCCGACGAGAAGAGGCCGGTCGTCGACGGCGGCGACGACAAGAAGCCG
ATTGCCGAACCGGCCGATGTCGTCCCGGGCCACAAGGCGCAGGAGGCGGGCGTCGTCGGTACCGCCCTCACCACG
TCCACTCCTACTGCCGCTCCCGTCGTCGAGGAGAAGAAGAGTGAGGCTGCTGCGTGA
Gene >Ophio5|825
ATGTCTGGCGAGCCCTCGCCCACGTCGACGCTGCACTCGCGCGTCGTCACGGGCCTCACCTCCAACAATGGAGGC
GAGGCTGTGCCCGACGAAGATCCGACGACGGTAGGTCCGCTAGACGGCCGCCACCAATGGCCGAGAGCCCGCTGA
TTTGTTCCTGTTGTCCGTCAGACGGCCGGTCTGCTCGCCGAGCGCCTTCAGGCCTGGAAGCACGCCGTGTCCTAC
CTGGATGAGTACATGATCGTCGTCGAGAAGATTCACGGCCGCCAGGCCAAGGAGTACGAGAAGGCGCTCAAGGTA
GGAAAGTTATGCTGCCTATATCCAATCGAATTCGATACTAAAGGCAACAACAGATGATATCCAACCCTTTGCGCC
AGGGCCATCATTTCGATCAGAGCCTGGGCGGCATCGCCGGCTTCTTCGAAAATGTGCGCGCCAACACGCAGTCCC
TCATCAACACCAATCTCGAGACGGAAAAGAGCCTCAAGGGTTCCGTCTTGCCTATCCTCGACCGCCTGCACAAGG
AGATCAAGCACAAGTCCAAGGAGCTGCAAAGCGGCGCCCAGAGCGGCGCAAAGGAGCTCGAGAAGCTGCGCAACG
CAACCCAGAAGCAGATCGAGCTGCTGGGCCAGCAGACGGCCTCGTACGATTCGGCTGGCGGCCGCTTCCACGGCC
ACGACGACCCTTACGTGGTGATGCGCTCCGTCATGCACCGGCTGAGCAACCAGGTCGTGGCCGAGAACAACCATC
ACAACGACCTGGTGGCCGTGCAGGGCAACTTCAAGACGTTCGAGGCGCACATTATCGCCGTGCTCCAGCAGGCCG
TCGAGGCCTTTGTTCAGCTCGTCGGCGGCCAGGGCGAGAAGACGCGCGCCCTCTTCAGCGACATGCTCGGTACCG
TCCAGGCCGTCCCCTCGGACTTTGAATGGGTCAACTTCGCCCACCGCTGCGCCAGCAGGCTGGCCAACCCGGCCG
ATCCTCCTCGCTCCGTCGACGCCATCCAGTTCCCTAACATGGACCACGGCTCGACCAAGCCGCTGATAGAGGGCT
CGCTCGAGCGCAAGTCGCGCAACAAGCTCTCGTGGGGCCTGTCGACGGGCTACTACGTCGTCACCCCGGCCCGCT
ACCTGCACGAGTTCAAGGACTCGGACGACACGCGTCAGGATCCCAAGCCCGAGCTGTCCATCTACCTTCCCGACG
CCACCATCGGCGCCCCGCACGAGGACCGCTTCACCGTCAAGGGCAAGGACCGCAGCAAGACGCTCAGCAGCAAAC
TGACGGGCAGCTCCGAGCTGTCCTTCAAGGCCCACACCCCGGAAGACGCCATGAAGTGGTTCCAGGTCATCCACG
CCGTCAGCAGCTCCGGCGCCGCCTCCTCCGAACCCGGCTCGCCTGCCGTCGATACCTCGGCGGCGGCGACGACGA
CGACTCCGACGGCCGGCACGACGCCGACGACGCCCAAGACTCCGACGACGCCCATGACGCCAACCACGACGACGG
CCGACGAGAAGAGGCCGGTCGTCGACGGCGGCGACGACAAGAAGCCGATTGCCGAACCGGCCGATGTCGTCCCGG
GCCACAAGGCGCAGGAGGCGGGCGTCGTCGGTACCGCCCTCACCACGTCCACTCCTACTGCCGCTCCCGTCGTCG
AGGAGAAGAAGAGTGAGGCTGCTGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail