Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|824
Gene name
Locationscaffold_1238:338..2499
Strand+
Gene length (bp)2161
Transcript length (bp)2004
Coding sequence length (bp)2001
Protein length (aa) 667

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03142 Chitin_synth_2 Chitin synthase 1.5E-16 254 423
PF13632 Glyco_trans_2_3 Glycosyl transferase family group 2 3.6E-14 255 489
PF13641 Glyco_tranf_2_3 Glycosyltransferase like family 2 1.2E-07 140 417

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P78746|CHSD_ASPFU Chitin synthase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=chsD PE=3 SV=1 67 654 0.0E+00
sp|O13353|CHS4_MAGO7 Chitin synthase 4 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CHS4 PE=3 SV=2 255 429 1.0E-10
sp|Q4P9K9|CHS8_USTMA Chitin synthase 8 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS8 PE=3 SV=1 254 427 2.0E-10
sp|P78611|CHSD_EMENI Chitin synthase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsD PE=3 SV=4 255 429 3.0E-10
sp|J9VXM5|CHS3_CRYNH Chitin synthase 3 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CHS3 PE=3 SV=1 282 427 3.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P78746|CHSD_ASPFU Chitin synthase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=chsD PE=3 SV=1 67 654 0.0E+00
sp|O13353|CHS4_MAGO7 Chitin synthase 4 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CHS4 PE=3 SV=2 255 429 1.0E-10
sp|Q4P9K9|CHS8_USTMA Chitin synthase 8 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS8 PE=3 SV=1 254 427 2.0E-10
sp|P78611|CHSD_EMENI Chitin synthase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsD PE=3 SV=4 255 429 3.0E-10
sp|J9VXM5|CHS3_CRYNH Chitin synthase 3 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CHS3 PE=3 SV=1 282 427 3.0E-10
sp|P29465|CHS3_YEAST Chitin synthase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHS3 PE=1 SV=3 255 429 5.0E-10
sp|P87073|CHS1_PHYB8 Chitin synthase 1 OS=Phycomyces blakesleeanus (strain ATCC 8743b / FGSC 10004 / NBRC 33097 / NRRL 1555) GN=chs1 PE=3 SV=1 281 511 9.0E-10
sp|P0DB60|HASA_STRP3 Hyaluronan synthase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=hasA PE=3 SV=1 141 511 1.0E-09
sp|Q01285|CHS4_NEUCR Chitin synthase 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=chs-4 PE=3 SV=3 255 429 1.0E-09
sp|P0C0H1|HASA_STRP1 Hyaluronan synthase OS=Streptococcus pyogenes serotype M1 GN=hasA PE=3 SV=1 141 511 1.0E-09
sp|P0DB61|HASA_STRPQ Hyaluronan synthase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=hasA PE=3 SV=1 141 511 1.0E-09
sp|Q8NKX1|HASA_STRP8 Hyaluronan synthase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=hasA PE=3 SV=1 141 511 1.0E-09
sp|P0C0H0|HASA_STRPY Hyaluronan synthase OS=Streptococcus pyogenes GN=hasA PE=3 SV=1 141 511 1.0E-09
sp|Q5X9A9|HASA_STRP6 Hyaluronan synthase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=hasA PE=3 SV=1 141 511 1.0E-09
sp|P30594|CHS1_RHIOL Chitin synthase 1 OS=Rhizopus oligosporus GN=CHS1 PE=3 SV=1 307 477 2.0E-09
sp|O13394|CHS5_USTMA Chitin synthase 5 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS5 PE=3 SV=3 254 429 2.0E-09
sp|P08004|CHS1_YEAST Chitin synthase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHS1 PE=1 SV=2 307 433 1.0E-08
sp|P30573|CHS3_CANAX Chitin synthase 3 OS=Candida albicans GN=CHS3 PE=3 SV=1 254 429 1.0E-08
sp|P30595|CHS2_RHIOL Chitin synthase 2 OS=Rhizopus oligosporus GN=CHS2 PE=3 SV=1 281 457 2.0E-08
sp|O13395|CHS6_USTMA Chitin synthase 6 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS6 PE=3 SV=2 254 422 2.0E-08
sp|O13356|CHS1_CRYNH Chitin synthase 1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CHS1 PE=3 SV=2 255 422 1.0E-07
sp|P30588|CHS3_NEUCR Chitin synthase 3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=chs-3 PE=3 SV=2 274 514 2.0E-07
sp|P30583|CHSC_EMENI Chitin synthase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsC PE=3 SV=3 307 483 6.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.5

Transmembrane Domains

Domain # Start End Length
1 20 41 21
2 54 76 22
3 98 120 22
4 453 470 17
5 480 502 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 136.16 69.03 203.30
CcL In ants, during behavior modification 88.53 46.45 130.60
CcD In ants, recently dead 85.93 45.69 126.17

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.066536 no
SC16a CcD 0.051376 no
CcL CcD 0.919176 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|824
MAAIHEWPVKDIVYTSVVGVLMLMACLEWFLWLAAFGYCLLKVFRKAEHWSIRLLCVGVGIAFALLRFIFLPIMV
VTLPLPNQVSRHWPTAAVSFLQWFAFWSFAILLTVPWLFCIYQLVTNQLGRTKRIKRVLDDATAPKVVVVMPCYR
EELDVLVKAINSVVDCDYPPACIHVFLSFDGEQVDDLYLNTVEMLGVPLFTDAAYPRSIDVTYRAARITISRFPH
GGKRHCQKSTFKLIDKVYAQYLKRNDNLFILFIDSDCILDKVCLQNFVYDMELSPGNARDMLAMTGVITSTTRKH
SVITLLQDMEYIHGQLFERTVESGCGSVTCLPGALTMLRFSAFRRMAKYYFADKAEQCDDLFDFAKCHLGEDRWL
THLFMIGAKKRHQIQMCTSAFCKTEAVQTYRSLVKQRRRWFLGFVTNEVCMLTDWRLWKRYPTLIVVRFMQNTIR
TTALLFFIMVLALLTTVVKVDNLPLRRFKVWLYPLMFVLNPFFNWYYMVYGIFTAGQRTWGGPRADAAAADSNTT
AQEAVERAEMQGDELNVVPESFKPAQEARRAVSKARSRVSVLNRQRSVVRPPDNIDGKFSARQRMATGIYAHPDE
TSAMVGEMPTKRLDSWNGDWRDSLESFESGRSDCKASSAAVKVDVFMGDEDRRKYLIAHYAQMQRKL
Coding >Ophio5|824
ATGGCCGCCATACACGAATGGCCGGTCAAGGACATCGTCTACACCTCTGTTGTTGGGGTGTTGATGCTCATGGCC
TGTCTCGAGTGGTTCCTTTGGCTCGCGGCCTTTGGCTACTGCCTTCTCAAGGTCTTTCGAAAAGCCGAGCACTGG
TCCATCCGTCTCCTCTGCGTTGGCGTGGGCATTGCGTTCGCCTTGCTCCGCTTCATCTTTCTACCGATCATGGTG
GTGACGCTGCCGCTTCCGAATCAGGTTTCGCGGCACTGGCCCACGGCCGCTGTGTCCTTTTTGCAATGGTTCGCT
TTTTGGAGTTTTGCAATCCTGCTCACCGTGCCCTGGCTATTCTGCATCTACCAGCTTGTCACCAACCAACTTGGC
CGCACTAAGCGCATTAAGCGGGTGCTCGACGATGCGACTGCCCCAAAGGTGGTCGTTGTCATGCCTTGCTACCGT
GAAGAGCTCGATGTGCTGGTCAAAGCCATCAACTCGGTCGTCGACTGTGACTACCCGCCGGCCTGCATCCACGTC
TTTCTGTCCTTCGACGGTGAGCAGGTGGACGACCTCTATCTCAACACCGTCGAGATGTTGGGAGTGCCTCTTTTC
ACAGACGCCGCATACCCCAGGAGCATCGATGTTACGTACAGGGCGGCCCGCATCACCATATCCCGCTTCCCCCAC
GGCGGCAAGCGGCACTGCCAAAAGTCCACCTTCAAGCTCATCGACAAGGTGTATGCGCAGTATTTGAAGAGAAAC
GACAATCTTTTCATTCTCTTCATCGACTCGGACTGCATACTGGACAAGGTCTGTTTGCAGAACTTTGTGTACGAT
ATGGAGCTCAGCCCGGGAAATGCCAGGGACATGCTGGCAATGACAGGCGTCATCACGTCGACGACTCGGAAGCAT
AGTGTTATTACGCTCCTCCAAGACATGGAGTACATCCATGGGCAGCTTTTCGAGCGCACCGTTGAGTCAGGCTGC
GGATCGGTCACTTGCCTGCCAGGCGCGCTTACTATGCTTCGCTTCTCGGCCTTTAGGAGGATGGCCAAGTATTAC
TTTGCGGATAAGGCGGAGCAGTGCGACGATCTTTTCGACTTCGCCAAATGCCACTTGGGCGAGGACCGGTGGCTC
ACACATCTGTTCATGATTGGCGCAAAGAAACGGCATCAAATTCAGATGTGCACGTCGGCCTTTTGCAAAACCGAG
GCCGTGCAGACTTATCGTTCCTTGGTTAAGCAGCGGCGCCGATGGTTCCTTGGCTTCGTCACTAACGAGGTCTGC
ATGTTGACCGACTGGCGACTGTGGAAGCGTTATCCGACCTTGATCGTCGTGCGCTTCATGCAGAACACCATCCGC
ACCACGGCCCTGCTTTTCTTCATCATGGTCCTGGCTCTTCTGACAACTGTAGTCAAGGTCGACAACCTCCCACTG
CGCCGCTTTAAAGTCTGGCTGTATCCACTAATGTTCGTCTTAAACCCCTTTTTCAACTGGTACTACATGGTTTAC
GGCATTTTTACCGCGGGCCAGAGAACATGGGGCGGTCCACGGGCCGATGCTGCGGCAGCCGACAGTAACACGACG
GCACAGGAGGCCGTGGAGCGAGCCGAAATGCAAGGTGATGAGCTCAACGTGGTGCCCGAGTCCTTCAAGCCGGCA
CAAGAGGCGCGGAGAGCCGTAAGCAAAGCACGATCGCGAGTATCGGTGCTCAACCGGCAGAGGAGTGTGGTCAGG
CCTCCGGACAATATTGACGGTAAGTTCTCGGCTAGACAGAGAATGGCGACTGGCATCTACGCGCATCCCGACGAA
ACCTCGGCAATGGTTGGTGAAATGCCCACTAAAAGGTTGGACAGTTGGAATGGCGACTGGCGTGATTCACTGGAA
AGCTTTGAGTCGGGTCGCTCAGACTGCAAGGCTTCATCCGCTGCAGTGAAGGTAGATGTATTTATGGGAGACGAA
GATCGTCGCAAATATCTAATAGCACATTATGCTCAGATGCAGCGCAAGTTA
Transcript >Ophio5|824
ATGGCCGCCATACACGAATGGCCGGTCAAGGACATCGTCTACACCTCTGTTGTTGGGGTGTTGATGCTCATGGCC
TGTCTCGAGTGGTTCCTTTGGCTCGCGGCCTTTGGCTACTGCCTTCTCAAGGTCTTTCGAAAAGCCGAGCACTGG
TCCATCCGTCTCCTCTGCGTTGGCGTGGGCATTGCGTTCGCCTTGCTCCGCTTCATCTTTCTACCGATCATGGTG
GTGACGCTGCCGCTTCCGAATCAGGTTTCGCGGCACTGGCCCACGGCCGCTGTGTCCTTTTTGCAATGGTTCGCT
TTTTGGAGTTTTGCAATCCTGCTCACCGTGCCCTGGCTATTCTGCATCTACCAGCTTGTCACCAACCAACTTGGC
CGCACTAAGCGCATTAAGCGGGTGCTCGACGATGCGACTGCCCCAAAGGTGGTCGTTGTCATGCCTTGCTACCGT
GAAGAGCTCGATGTGCTGGTCAAAGCCATCAACTCGGTCGTCGACTGTGACTACCCGCCGGCCTGCATCCACGTC
TTTCTGTCCTTCGACGGTGAGCAGGTGGACGACCTCTATCTCAACACCGTCGAGATGTTGGGAGTGCCTCTTTTC
ACAGACGCCGCATACCCCAGGAGCATCGATGTTACGTACAGGGCGGCCCGCATCACCATATCCCGCTTCCCCCAC
GGCGGCAAGCGGCACTGCCAAAAGTCCACCTTCAAGCTCATCGACAAGGTGTATGCGCAGTATTTGAAGAGAAAC
GACAATCTTTTCATTCTCTTCATCGACTCGGACTGCATACTGGACAAGGTCTGTTTGCAGAACTTTGTGTACGAT
ATGGAGCTCAGCCCGGGAAATGCCAGGGACATGCTGGCAATGACAGGCGTCATCACGTCGACGACTCGGAAGCAT
AGTGTTATTACGCTCCTCCAAGACATGGAGTACATCCATGGGCAGCTTTTCGAGCGCACCGTTGAGTCAGGCTGC
GGATCGGTCACTTGCCTGCCAGGCGCGCTTACTATGCTTCGCTTCTCGGCCTTTAGGAGGATGGCCAAGTATTAC
TTTGCGGATAAGGCGGAGCAGTGCGACGATCTTTTCGACTTCGCCAAATGCCACTTGGGCGAGGACCGGTGGCTC
ACACATCTGTTCATGATTGGCGCAAAGAAACGGCATCAAATTCAGATGTGCACGTCGGCCTTTTGCAAAACCGAG
GCCGTGCAGACTTATCGTTCCTTGGTTAAGCAGCGGCGCCGATGGTTCCTTGGCTTCGTCACTAACGAGGTCTGC
ATGTTGACCGACTGGCGACTGTGGAAGCGTTATCCGACCTTGATCGTCGTGCGCTTCATGCAGAACACCATCCGC
ACCACGGCCCTGCTTTTCTTCATCATGGTCCTGGCTCTTCTGACAACTGTAGTCAAGGTCGACAACCTCCCACTG
CGCCGCTTTAAAGTCTGGCTGTATCCACTAATGTTCGTCTTAAACCCCTTTTTCAACTGGTACTACATGGTTTAC
GGCATTTTTACCGCGGGCCAGAGAACATGGGGCGGTCCACGGGCCGATGCTGCGGCAGCCGACAGTAACACGACG
GCACAGGAGGCCGTGGAGCGAGCCGAAATGCAAGGTGATGAGCTCAACGTGGTGCCCGAGTCCTTCAAGCCGGCA
CAAGAGGCGCGGAGAGCCGTAAGCAAAGCACGATCGCGAGTATCGGTGCTCAACCGGCAGAGGAGTGTGGTCAGG
CCTCCGGACAATATTGACGGTAAGTTCTCGGCTAGACAGAGAATGGCGACTGGCATCTACGCGCATCCCGACGAA
ACCTCGGCAATGGTTGGTGAAATGCCCACTAAAAGGTTGGACAGTTGGAATGGCGACTGGCGTGATTCACTGGAA
AGCTTTGAGTCGGGTCGCTCAGACTGCAAGGCTTCATCCGCTGCAGTGAAGGTAGATGTATTTATGGGAGACGAA
GATCGTCGCAAATATCTAATAGCACATTATGCTCAGATGCAGCGCAAGTTATAA
Gene >Ophio5|824
ATGGCCGCCATACACGAATGGCCGGTCAAGGACGTCGGTGGCCGTCTACACTCTCACCGGGTCGACGCTTACCGT
TGTCGCAGATCGTCTACACCTCTGTTGTTGGGGTGTTGATGCTCATGGCCTGTCTCGAGTGGTTCCTTTGGCTCG
CGGCCTTTGGCTACTGCCTTCTCAAGGTCTTTCGAAAAGCCGAGCACTGGTCCATCCGTCTCCTCTGCGTTGGCG
TGGGCATTGCGTTCGCCTTGCTCCGGTATGGCTCCCGGCTCCCGGCCGGAGCAAGGCTGATAATTGCAGCTTCAT
CTTTCTACCGATCATGGTGGTGACGCTGCCGCTTCCGAATCAGGTTTCGCGGCACTGGCCCACGGCCGCTGTGTC
CTTTTTGCAATGGTTCGCTTTTTGGAGTTTTGCAATCCTGCTCACCGTGCCCTGGCTATTCTGCATCTACCAGCT
TGTCACCAACCAACTTGGCCGCACTAAGCGCATTAAGCGGGTGCTCGACGATGCGACTGCCCCAAAGGTGGTCGT
TGTCATGCCTTGCTACCGTGAAGAGCTCGATGTGCTGGTCAAAGCCATCAACTCGGTCGTCGACTGTGACTACCC
GCCGGCCTGCATCCACGTCTTTCTGTCCTTCGACGGTGAGCAGGTGGACGACCTCTATCTCAACACCGTCGAGAT
GTTGGGAGTGCCTCTTTTCACAGACGCCGCATACCCCAGGAGCATCGATGTTACGTACAGGGCGGCCCGCATCAC
CATATCCCGCTTCCCCCACGGCGGCAAGCGGCACTGCCAAAAGTCCACCTTCAAGCTCATCGACAAGGTGTATGC
GCAGTATTTGAAGAGAAACGACAATCTTTTCATTCTCTTCATCGACTCGGACTGCATACTGGACAAGGTCTGTTT
GCAGAACTTTGTGTACGATATGGAGCTCAGCCCGGGAAATGCCAGGGACATGCTGGCAATGACAGGCGTCATCAC
GTCGACGACTCGGAAGCATAGTGTTATTACGCTCCTCCAAGACATGGAGTACATCCATGGGCAGCTTTTCGAGCG
CACCGTTGAGTCAGGCTGCGGATCGGTCACTTGCCTGCCAGGCGCGCTTACTATGCTTCGCTTCTCGGCCTTTAG
GAGGATGGCCAAGTATTACTTTGCGGATAAGGCGGAGCAGTGCGACGATCTTTTCGACTTCGCCAAATGCCACTT
GGGCGAGGACCGGTGGCTCACACATCTGTTCATGATTGGCGCAAAGAAACGGCATCAAATTCAGATGTGCACGTC
GGCCTTTTGCAAAACCGAGGCCGTGCAGACTTATCGTTCCTTGGTTAAGCAGCGGCGCCGATGGTTCCTTGGCTT
CGTCACTAACGAGGTCTGCATGTTGACCGACTGGCGACTGTGGAAGCGTTATCCGACCTTGATCGTCGTGCGCTT
CATGCAGAACACCATCCGCACCACGGCCCTGCTTTTCTTCATCATGGTCCTGGCTCTTCTGACAACTGTAGTCAA
GGTCGACAACCTCCCAGTAGGTTTCATTGCCGTTTCACTCGGCCTCAACTGGCTCCTGATGCTATACTTTGGCGC
CAAGCTGCGCCGCTTTAAAGTCTGGCTGTATCCACTAATGTTCGTCTTAAACCCCTTTTTCAACTGGTACTACAT
GGTTTACGGCATTTTTACCGCGGGCCAGAGAACATGGGGCGGTCCACGGGCCGATGCTGCGGCAGCCGACAGTAA
CACGACGGCACAGGAGGCCGTGGAGCGAGCCGAAATGCAAGGTGATGAGCTCAACGTGGTGCCCGAGTCCTTCAA
GCCGGCACAAGAGGCGCGGAGAGCCGTAAGCAAAGCACGATCGCGAGTATCGGTGCTCAACCGGCAGAGGAGTGT
GGTCAGGCCTCCGGACAATATTGACGGTAAGTTCTCGGCTAGACAGAGAATGGCGACTGGCATCTACGCGCATCC
CGACGAAACCTCGGCAATGGTTGGTGAAATGCCCACTAAAAGGTTGGACAGTTGGAATGGCGACTGGCGTGATTC
ACTGGAAAGCTTTGAGTCGGGTCGCTCAGACTGCAAGGCTTCATCCGCTGCAGTGAAGGTAGATGTATTTATGGG
AGACGAAGATCGTCGCAAATATCTAATAGCACATTATGCTCAGATGCAGCGCAAGTTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail