Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8235
Gene name
Locationscaffold_891:434..3236
Strand+
Gene length (bp)2802
Transcript length (bp)2325
Coding sequence length (bp)2322
Protein length (aa) 774

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01067 Calpain_III Calpain large subunit, domain III 3.4E-06 514 622

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RZP7|PALB_NEUCR Calpain-like protease palB/cpr-8 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cpr-8 PE=3 SV=3 1 748 4.0E-171
sp|Q9Y6Z8|PALB_ASPOR Calpain-like protease palB/RIM13 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=palB PE=3 SV=1 3 771 6.0E-137
sp|Q00204|PALB_EMENI Calpain-like protease palB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=palB PE=3 SV=2 6 771 3.0E-136
sp|Q9Y6W3|CAN7_HUMAN Calpain-7 OS=Homo sapiens GN=CAPN7 PE=1 SV=1 117 633 5.0E-39
sp|A0FKG7|CAN7_PIG Calpain-7 OS=Sus scrofa GN=CAPN7 PE=2 SV=1 117 633 1.0E-37
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RZP7|PALB_NEUCR Calpain-like protease palB/cpr-8 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cpr-8 PE=3 SV=3 1 748 4.0E-171
sp|Q9Y6Z8|PALB_ASPOR Calpain-like protease palB/RIM13 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=palB PE=3 SV=1 3 771 6.0E-137
sp|Q00204|PALB_EMENI Calpain-like protease palB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=palB PE=3 SV=2 6 771 3.0E-136
sp|Q9Y6W3|CAN7_HUMAN Calpain-7 OS=Homo sapiens GN=CAPN7 PE=1 SV=1 117 633 5.0E-39
sp|A0FKG7|CAN7_PIG Calpain-7 OS=Sus scrofa GN=CAPN7 PE=2 SV=1 117 633 1.0E-37
sp|Q9R1S8|CAN7_MOUSE Calpain-7 OS=Mus musculus GN=Capn7 PE=2 SV=1 117 633 2.0E-37
sp|Q9HFC8|PALB_YARLI Calpain-like protease palB/RIM13 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RIM13 PE=3 SV=1 229 641 6.0E-31
sp|P0CQ06|PALB_CRYNJ Calpain-like protease palB/RIM13 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RIM13 PE=3 SV=1 223 656 5.0E-28
sp|P0CQ07|PALB_CRYNB Calpain-like protease palB/RIM13 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RIM13 PE=3 SV=1 223 656 5.0E-28
sp|Q6BH66|PALB_DEBHA Calpain-like protease palB/RIM13 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DEHA2G20988g PE=3 SV=2 158 627 2.0E-26
sp|Q5AK25|PALB_CANAL Calpain-like protease palB/RIM13 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RIM13 PE=3 SV=1 223 634 9.0E-19
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8235
METKAQAAEALLARASGKVALGHAIRAAELYMIAAGETSNKAHASRLRNKCQEMIALAEKLKIWQTPALSSSHSD
ILLAASRLHDNYFPPWDGDPDDVEFELPPGSELYTDDAPFTLSKTQAGNFAGWTRPAELFGLGPDRDTSQDEEVM
MQLHGHCDLVQDITTDCSVVASLSAAAKVMVGPHAVLSTILYPFDHVEGRPRLSRSGKPSKSLPTMACSIGEGVS
ERTDLWVLTGWIPEQLFLQVEELDFDETWERVKAAHESRDVVVTLGTGRISAEEERLMGLIGEHDYAVEDIESSD
GITRKLLIKNPWRDAPLIVGTGGAKSQGRCGRDNTTWITLEDVAQHFETMYLNWNPDLFCCRQDHHFTWEMPPRY
LATSLVKNPQYALSSASGGSVWVLVSRHFADAELEIARSRRGSLAAVAQQLGFMSILVFDNGGKTAHVSGSETYR
GPYVDCPQTLARLEASPGRRYTIVVDQHELPLPSYTLTLTLFSNSSLEVKPAEERMSHSEERTGCWNRRNAGGNS
SRATYHRNPQYKLMTTKHTPISILLSTDNREVQVHIDVVWARGERVTTVRVKDLVFSSGEYRRGCALANISTLEP
GAYTLVCSTFEAGQMATFAVRVSSMSPVALDRLPAASAGRLRTPLTTFEPVRGEGGARAPLKALWLTRASISVHN
VLLPDAANGARHASSLLLRVSVVLGWGPDQVTVAASGEGQYRQPTADLRTGDFDLEPGRVNREGMWLVIECIGSH
QALWAVDGEILSESPIHIGVWESM
Coding >Ophio5|8235
ATGGAAACCAAGGCGCAGGCTGCCGAGGCTCTACTTGCACGTGCAAGCGGCAAGGTCGCCCTCGGCCATGCGATT
CGAGCCGCCGAGCTTTACATGATAGCCGCCGGCGAGACGTCAAACAAGGCACACGCTAGTCGCCTCAGGAACAAG
TGCCAAGAAATGATTGCTCTCGCTGAGAAGCTCAAAATATGGCAGACGCCGGCCCTGTCGTCTTCCCATTCTGAC
ATCCTTCTTGCCGCCTCACGCTTGCATGACAACTACTTCCCTCCTTGGGATGGGGATCCCGACGATGTCGAATTC
GAGCTGCCGCCTGGCTCGGAATTGTACACAGATGATGCCCCTTTCACACTCTCGAAGACCCAGGCAGGGAACTTC
GCAGGCTGGACCAGACCGGCGGAGCTTTTCGGGCTTGGACCTGACCGCGATACAAGCCAAGACGAGGAGGTTATG
ATGCAGCTTCATGGGCATTGCGATCTCGTTCAGGACATAACAACAGACTGCTCCGTTGTCGCCAGTCTTTCCGCA
GCCGCCAAGGTTATGGTCGGGCCCCATGCTGTTCTCTCTACCATCCTATATCCGTTTGATCACGTCGAGGGGCGC
CCACGGCTGTCCCGCTCGGGCAAACCGTCGAAATCCTTGCCTACTATGGCCTGCTCTATTGGAGAAGGCGTATCT
GAAAGAACTGATCTGTGGGTTCTAACTGGTTGGATACCTGAGCAACTCTTTCTCCAGGTAGAGGAACTCGATTTT
GACGAGACTTGGGAGAGAGTCAAGGCAGCTCACGAGTCTCGCGACGTAGTCGTGACCCTAGGCACGGGACGGATT
TCTGCTGAAGAGGAACGACTCATGGGTCTCATCGGCGAGCATGATTACGCTGTGGAGGATATCGAATCGTCCGAC
GGTATCACACGCAAGCTGCTCATTAAGAACCCTTGGCGCGATGCTCCCTTGATCGTAGGAACCGGAGGTGCTAAG
AGTCAGGGCCGCTGTGGTCGCGACAATACAACATGGATAACGCTGGAAGATGTCGCACAGCACTTCGAGACCATG
TATCTGAACTGGAATCCCGACTTGTTTTGTTGTCGCCAAGACCATCACTTCACTTGGGAGATGCCTCCCAGATAT
CTTGCGACCTCGTTGGTCAAAAACCCCCAATACGCGCTCTCGTCCGCCAGCGGCGGTTCCGTTTGGGTCCTGGTC
AGTCGCCATTTTGCAGACGCTGAGCTCGAAATAGCTCGCAGTAGGCGCGGGTCTCTGGCCGCTGTTGCGCAACAG
CTTGGCTTCATGAGTATCCTTGTCTTTGATAATGGAGGAAAGACAGCGCATGTCAGTGGATCAGAGACTTACCGC
GGACCTTATGTCGATTGTCCGCAAACACTCGCGCGCCTCGAGGCCAGTCCTGGTAGGAGGTATACAATCGTCGTC
GATCAACACGAGTTGCCTTTGCCTAGCTACACCTTGACCTTGACACTGTTTTCCAACTCGTCACTGGAAGTCAAG
CCAGCAGAAGAGAGAATGTCTCATAGCGAGGAGCGGACAGGGTGCTGGAACCGACGTAACGCCGGTGGCAACTCG
TCGAGGGCGACTTATCACAGAAACCCCCAATATAAGCTGATGACAACCAAGCACACCCCCATCTCTATCCTCCTG
TCTACCGACAACCGAGAAGTTCAAGTCCACATTGATGTTGTATGGGCTCGCGGGGAGCGAGTAACAACTGTGCGT
GTGAAGGATCTCGTCTTCTCTTCCGGAGAGTATCGCCGCGGATGCGCCCTAGCAAATATCTCCACACTGGAGCCT
GGGGCTTACACATTGGTCTGCTCGACATTTGAGGCTGGCCAGATGGCCACTTTTGCAGTTCGAGTCTCGTCCATG
TCGCCTGTTGCCCTGGATCGTCTGCCAGCTGCTTCGGCTGGCAGGCTACGAACACCACTCACAACCTTCGAACCG
GTCAGGGGGGAAGGGGGTGCGCGTGCCCCGTTGAAAGCATTGTGGCTGACGCGTGCGAGTATCTCTGTGCATAAT
GTCTTGCTGCCCGACGCTGCAAACGGAGCGCGACACGCGTCGTCTCTGTTGCTCCGAGTTTCTGTCGTTCTAGGT
TGGGGCCCGGACCAAGTTACGGTTGCAGCTTCTGGTGAAGGACAGTATCGTCAACCGACGGCAGATCTACGAACT
GGTGATTTCGACTTGGAACCCGGCCGGGTAAATAGGGAAGGCATGTGGCTCGTTATTGAATGCATTGGATCGCAC
CAGGCTTTATGGGCCGTCGACGGCGAGATCCTCAGCGAGTCGCCTATACACATTGGCGTATGGGAGTCTATG
Transcript >Ophio5|8235
ATGGAAACCAAGGCGCAGGCTGCCGAGGCTCTACTTGCACGTGCAAGCGGCAAGGTCGCCCTCGGCCATGCGATT
CGAGCCGCCGAGCTTTACATGATAGCCGCCGGCGAGACGTCAAACAAGGCACACGCTAGTCGCCTCAGGAACAAG
TGCCAAGAAATGATTGCTCTCGCTGAGAAGCTCAAAATATGGCAGACGCCGGCCCTGTCGTCTTCCCATTCTGAC
ATCCTTCTTGCCGCCTCACGCTTGCATGACAACTACTTCCCTCCTTGGGATGGGGATCCCGACGATGTCGAATTC
GAGCTGCCGCCTGGCTCGGAATTGTACACAGATGATGCCCCTTTCACACTCTCGAAGACCCAGGCAGGGAACTTC
GCAGGCTGGACCAGACCGGCGGAGCTTTTCGGGCTTGGACCTGACCGCGATACAAGCCAAGACGAGGAGGTTATG
ATGCAGCTTCATGGGCATTGCGATCTCGTTCAGGACATAACAACAGACTGCTCCGTTGTCGCCAGTCTTTCCGCA
GCCGCCAAGGTTATGGTCGGGCCCCATGCTGTTCTCTCTACCATCCTATATCCGTTTGATCACGTCGAGGGGCGC
CCACGGCTGTCCCGCTCGGGCAAACCGTCGAAATCCTTGCCTACTATGGCCTGCTCTATTGGAGAAGGCGTATCT
GAAAGAACTGATCTGTGGGTTCTAACTGGTTGGATACCTGAGCAACTCTTTCTCCAGGTAGAGGAACTCGATTTT
GACGAGACTTGGGAGAGAGTCAAGGCAGCTCACGAGTCTCGCGACGTAGTCGTGACCCTAGGCACGGGACGGATT
TCTGCTGAAGAGGAACGACTCATGGGTCTCATCGGCGAGCATGATTACGCTGTGGAGGATATCGAATCGTCCGAC
GGTATCACACGCAAGCTGCTCATTAAGAACCCTTGGCGCGATGCTCCCTTGATCGTAGGAACCGGAGGTGCTAAG
AGTCAGGGCCGCTGTGGTCGCGACAATACAACATGGATAACGCTGGAAGATGTCGCACAGCACTTCGAGACCATG
TATCTGAACTGGAATCCCGACTTGTTTTGTTGTCGCCAAGACCATCACTTCACTTGGGAGATGCCTCCCAGATAT
CTTGCGACCTCGTTGGTCAAAAACCCCCAATACGCGCTCTCGTCCGCCAGCGGCGGTTCCGTTTGGGTCCTGGTC
AGTCGCCATTTTGCAGACGCTGAGCTCGAAATAGCTCGCAGTAGGCGCGGGTCTCTGGCCGCTGTTGCGCAACAG
CTTGGCTTCATGAGTATCCTTGTCTTTGATAATGGAGGAAAGACAGCGCATGTCAGTGGATCAGAGACTTACCGC
GGACCTTATGTCGATTGTCCGCAAACACTCGCGCGCCTCGAGGCCAGTCCTGGTAGGAGGTATACAATCGTCGTC
GATCAACACGAGTTGCCTTTGCCTAGCTACACCTTGACCTTGACACTGTTTTCCAACTCGTCACTGGAAGTCAAG
CCAGCAGAAGAGAGAATGTCTCATAGCGAGGAGCGGACAGGGTGCTGGAACCGACGTAACGCCGGTGGCAACTCG
TCGAGGGCGACTTATCACAGAAACCCCCAATATAAGCTGATGACAACCAAGCACACCCCCATCTCTATCCTCCTG
TCTACCGACAACCGAGAAGTTCAAGTCCACATTGATGTTGTATGGGCTCGCGGGGAGCGAGTAACAACTGTGCGT
GTGAAGGATCTCGTCTTCTCTTCCGGAGAGTATCGCCGCGGATGCGCCCTAGCAAATATCTCCACACTGGAGCCT
GGGGCTTACACATTGGTCTGCTCGACATTTGAGGCTGGCCAGATGGCCACTTTTGCAGTTCGAGTCTCGTCCATG
TCGCCTGTTGCCCTGGATCGTCTGCCAGCTGCTTCGGCTGGCAGGCTACGAACACCACTCACAACCTTCGAACCG
GTCAGGGGGGAAGGGGGTGCGCGTGCCCCGTTGAAAGCATTGTGGCTGACGCGTGCGAGTATCTCTGTGCATAAT
GTCTTGCTGCCCGACGCTGCAAACGGAGCGCGACACGCGTCGTCTCTGTTGCTCCGAGTTTCTGTCGTTCTAGGT
TGGGGCCCGGACCAAGTTACGGTTGCAGCTTCTGGTGAAGGACAGTATCGTCAACCGACGGCAGATCTACGAACT
GGTGATTTCGACTTGGAACCCGGCCGGGTAAATAGGGAAGGCATGTGGCTCGTTATTGAATGCATTGGATCGCAC
CAGGCTTTATGGGCCGTCGACGGCGAGATCCTCAGCGAGTCGCCTATACACATTGGCGTATGGGAGTCTATGTAA
Gene >Ophio5|8235
ATGGAAACCAAGGCGCAGGTAACAACCCGTCTGGTGCAGCAAGCATCAAAGTCGTCCAACTGACTCGGCTGTTGA
CAAGGCTGCCGAGGCTCTACTTGCACGTGCAAGCGGCAAGGTCGCCCTCGGCCATGCGATTCGAGCCGCCGAGCT
TTACATGATAGCCGCCGGCGAGACGTCAAACAAGGCACACGCTAGTCGCCTCAGGAACAAGTGCCAAGAAATGAT
TGCTCTCGCTGAGAAGCTCAAAATATGGCAGACGCCGGCCCTGTCGTCTTCCCATTCTGACATCCTTCTTGCCGC
CTCACGCTTGCATGACAACTACTTCCCTCCTTGGGATGGGGATCCCGACGATGTCGAATTCGAGCTGCCGCCTGG
CTCGGAATTGTACACGTGAGTGTATGCCGTCTTTCGACAGACAGATCTATAGCCGCGCCCTTTGACCAACGTTGA
ATTCAAGAGATGATGCCCCTTTCACACTCTCGAAGACCCAGGCAGGGAACTTCGCAGGCTGGACCAGACCGGCGG
AGCTTTTCGGGCTTGGACCTGACCGCGATACAAGCCAAGACGAGGAGGTTATGATGCAGCTTCATGGGCATTGCG
ATCTCGTTCAGGACATAACAACAGACTGCTCCGTTGTCGCCAGTCTTTCCGCAGCCGCCAAGGTTATGGTCGGGC
CCCATGCTGTATGTGCAAGCAACGGACCGTTCGCTCGTTCTTGTTCTCACGTAATTATGGCACTGTCAATAATAA
CAATTTTCACCAGGTTCTCTCTACCATCCTATATCCGTTTGATCACGTCGAGGGGCGCCCACGGCTGTCCCGCTC
GGGCAAGTATGTGTTGCGCATGAACTTCAATGGCTGCTCAAGGCGAGTCGTGGTTGACGACAGGCTTCCTGCCTC
CCGCACTGATCGCACTCTTTTCGTCGTAGACCGTCGAAATCCTTGCCTACTATGGCCTGCTCTATTGGAGAAGGC
GTATCTGAAAGTGAGAGGCGGCTATGATTTCCCAGGGAGCAACTCAGGAACTGATCTGTGGGTTCTAACTGGTTG
GATACCTGAGCAACTCTTTCTCCAGGTGTAGGTCAAGTCTCCCGTCGCAGCCTCCTGACACTGTCACTGGCATAG
CTCGCTCACTAACATCTTCATAAGAGAGGAACTCGATTTTGACGAGACTTGGGAGAGAGTCAAGGCAGCTCACGA
GTCTCGCGACGTAGTCGTGACCCTAGGCACGGGACGGATTTCTGCTGAAGAGGAACGACTCATGGGTCTCATCGG
CGAGCATGATTACGCTGTGGAGGATATCGAATCGTCCGACGGTATCACACGCAAGCTGCTCATTAAGAACCCTTG
GCGCGATGCTCCCTTGATCGTAGGAACCGGAGGTGCTAAGAGTCAGGGCCGCTGTGGTCGCGACAAGTGAGCCGC
CTCTGCCGCCTTACTTAAATTAATAGTGGCTGACCCACTACCTGTTCTATCAGTACAACATGGATAACGCTGGAA
GATGTCGCACAGCACTTCGAGACCATGTATCTGAACTGGAATCCCGACTTGTTTTGTTGTCGCCAAGACCATCAC
TTCACTTGGGAGATGCCTCCCAGATATCTTGCGACCTCGTTGGTCAAAAACCCCCAATACGCGCTCTCGTCCGCC
AGCGGCGGTTCCGTTTGGGTCCTGGTCAGTCGCCATTTTGCAGACGCTGAGCTCGAAATAGCTCGCAGTAGGCGC
GGGTCTCTGGCCGCTGTTGCGCAACAGCTTGGCTTCATGAGTATCCTTGTCTTTGATAATGGAGGAAAGACAGCG
CATGTCAGTGGATCAGAGACTTACCGCGGACCTTATGTCGATTGTCCGCAAACACTCGCGCGCCTCGAGGCCAGT
CCTGGTAGGAGGTATACAATCGTCGTCGATCAACACGAGTTGCCTTTGCCTAGCTACACCTTGACCTTGACACTG
TTTTCCAACTCGTCACTGGAAGTCAAGCCAGCAGAAGAGAGAATGTCTCATAGCGAGGAGCGGACAGGGTGCTGG
AACCGACGTAACGCCGGTGGCAACTCGTCGAGGGCGACTTATCACAGAAACCCCCAATATAAGCTGATGACAACC
AAGCACACCCCCATCTCTATCCTCCTGTCTACCGACAACCGAGAAGTTCAAGTCCACATTGATGTTGTATGGGCT
CGCGGGGAGCGAGTAACAACTGTGCGTGTGAAGGATCTCGTCTTCTCTTCCGGAGAGTATCGCCGCGGATGCGCC
CTAGCAAATATCTCCACACTGGAGCCTGGGGCTTACACATTGGTCTGCTCGACATTTGAGGCTGGCCAGATGGCC
ACTTTTGCAGTTCGAGTCTCGTCCATGTCGCCTGTTGCCCTGGATCGTCTGCCAGCTGCTTCGGCTGGCAGGCTA
CGAACACCACTCACAACCTTCGAACCGGTCAGGGGGGAAGGGGGTGCGCGTGCCCCGTTGAAAGCATTGTGGCTG
ACGCGTGCGAGTATCTCTGTGCATAATGTCTTGCTGCCCGACGCTGCAAACGGAGCGCGACACGCGTCGTCTCTG
TTGCTCCGAGTTTCTGTCGTTCTAGGTTGGGGCCCGGACCAAGTTACGGTTGCAGCTTCTGGTGAAGGACAGTAT
CGTCAACCGACGGCAGATCTACGAACTGGTGATTTCGACTTGGAACCCGGCCGGGTAAATAGGGAAGGCATGTGG
CTCGTTATTGAATGCATTGGATCGCACCAGGCTTTATGGGCCGTCGACGGCGAGATCCTCAGCGAGTCGCCTATA
CACATTGGCGTATGGGAGTCTATGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail