Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|823
Gene name
Locationscaffold_1236:328..1960
Strand+
Gene length (bp)1632
Transcript length (bp)1512
Coding sequence length (bp)1509
Protein length (aa) 503

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear export signal 0.6472 0.58 0.1322 0.0488 0.3036 0.0145 0.1551 0.2535 0.1381 0.0223

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup714
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2421
Ophiocordyceps australis 1348a (Ghana) OphauG2|882
Ophiocordyceps australis map64 (Brazil) OphauB2|3723
Ophiocordyceps camponoti-floridani Ophcf2|03033
Ophiocordyceps camponoti-rufipedis Ophun1|7238
Ophiocordyceps kimflemingae Ophio5|823 (this protein)
Ophiocordyceps subramaniannii Hirsu2|158

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|823
MELTCPEETSPLAVLCPEILTLIIDDLRALDHRSVFIVRLACRILNSAATPVAYRAIHLNRGILNPCAGRLYPRL
LEHVSRFTHEVTVRSDLPSTDVRRVLSGIKRLSFVRWSYVAPDVVGSSSLRLPWDILDAEQVERSGIRVAVENLP
LGGVHCDLDESCFRPALTRRMVSLKLSSPKPPLTTRSGSLKRLVLQSPRLRTLHYRDLGIGTSFRFGRSERLPAV
VDLVLQSYNWDHSTDEVGRHWDFSRIRSLELVNMPVANFLASVRLRDFARLHTLRVEDYGGHLQDTRPSATVQLC
ELVRDHVEALETLDITCHTRLFELEAIGKHRHSLRVLRYRDHVGFEDDSKRCPTLGRAELRALGHRLGHVHTLEL
DMDAAPDDLVEAVCSFARLHTLTLHVQTQIRACDPVEPDRDRDREAALDVFGRLIGRRAWRRVMINVGGWRRAMV
RRMGYEWKRHNEQGVYAERCFWLERDQKGYSVGEEAALGGGPMPAIAGSMLGL
Coding >Ophio5|823
ATGGAGCTGACATGTCCCGAAGAGACGAGTCCGCTGGCCGTTCTGTGTCCGGAGATTCTGACGCTAATCATAGAC
GATTTGCGAGCTCTCGATCACAGGTCCGTCTTCATCGTGCGTCTTGCCTGCCGTATCTTGAACTCGGCGGCGACG
CCGGTCGCCTACCGTGCCATCCACCTCAACCGTGGCATACTCAACCCTTGCGCGGGGCGTCTATACCCCCGCCTG
CTCGAGCACGTATCCCGCTTCACGCACGAAGTGACGGTTCGCAGCGACCTGCCGTCGACGGACGTCCGACGAGTC
CTGTCCGGCATCAAGCGGTTGTCATTCGTCAGGTGGTCCTATGTGGCCCCAGATGTAGTCGGCTCTTCCAGCCTG
CGGTTGCCCTGGGACATTCTGGACGCCGAACAGGTGGAGCGCAGCGGTATCCGCGTCGCCGTCGAGAACCTGCCG
CTGGGAGGGGTGCACTGCGACCTGGACGAGTCGTGCTTCAGACCGGCCCTCACGCGGCGCATGGTATCGCTGAAG
CTGTCGAGTCCGAAGCCGCCGTTGACGACTCGGAGCGGCTCGCTCAAGCGGCTCGTGCTGCAGTCTCCGCGTCTG
CGGACGTTGCACTACCGCGACCTGGGCATCGGCACCAGCTTCCGTTTCGGCCGCTCGGAGCGGCTGCCGGCCGTC
GTCGACCTCGTGCTCCAGTCGTACAACTGGGATCACTCGACGGACGAGGTCGGACGGCACTGGGACTTTTCGCGG
ATCCGGTCCCTGGAGCTGGTCAACATGCCCGTGGCCAACTTTTTGGCGTCGGTCCGGCTCCGTGACTTTGCGCGC
CTTCACACGCTCCGGGTCGAGGACTACGGGGGCCACCTGCAGGACACGCGGCCGAGTGCGACGGTGCAACTGTGC
GAGCTGGTGCGGGACCACGTCGAGGCGCTCGAGACGCTCGACATTACCTGCCACACCCGGCTCTTCGAGCTCGAG
GCGATAGGGAAACACCGCCACTCACTGCGGGTGCTCCGGTACCGGGATCACGTCGGCTTCGAGGACGACAGCAAG
CGGTGCCCGACGCTGGGGCGGGCGGAGCTGAGGGCGCTGGGGCATCGCCTGGGACACGTGCACACGCTGGAGCTG
GACATGGACGCGGCACCGGACGACTTGGTCGAGGCCGTGTGCTCGTTCGCGCGGCTGCACACGCTGACGCTACAC
GTGCAGACGCAGATCCGAGCGTGCGACCCGGTAGAGCCGGACCGGGATCGGGACCGCGAGGCGGCGCTCGACGTG
TTCGGCCGGCTGATCGGACGGCGGGCGTGGCGGCGGGTGATGATCAACGTGGGCGGGTGGCGAAGGGCCATGGTG
CGGCGGATGGGATACGAGTGGAAACGGCACAACGAGCAGGGCGTATACGCCGAGCGGTGCTTTTGGCTCGAGAGG
GATCAGAAGGGCTACAGCGTGGGCGAGGAGGCGGCGCTTGGGGGGGGCCCTATGCCGGCCATCGCGGGCTCTATG
CTTGGGCTC
Transcript >Ophio5|823
ATGGAGCTGACATGTCCCGAAGAGACGAGTCCGCTGGCCGTTCTGTGTCCGGAGATTCTGACGCTAATCATAGAC
GATTTGCGAGCTCTCGATCACAGGTCCGTCTTCATCGTGCGTCTTGCCTGCCGTATCTTGAACTCGGCGGCGACG
CCGGTCGCCTACCGTGCCATCCACCTCAACCGTGGCATACTCAACCCTTGCGCGGGGCGTCTATACCCCCGCCTG
CTCGAGCACGTATCCCGCTTCACGCACGAAGTGACGGTTCGCAGCGACCTGCCGTCGACGGACGTCCGACGAGTC
CTGTCCGGCATCAAGCGGTTGTCATTCGTCAGGTGGTCCTATGTGGCCCCAGATGTAGTCGGCTCTTCCAGCCTG
CGGTTGCCCTGGGACATTCTGGACGCCGAACAGGTGGAGCGCAGCGGTATCCGCGTCGCCGTCGAGAACCTGCCG
CTGGGAGGGGTGCACTGCGACCTGGACGAGTCGTGCTTCAGACCGGCCCTCACGCGGCGCATGGTATCGCTGAAG
CTGTCGAGTCCGAAGCCGCCGTTGACGACTCGGAGCGGCTCGCTCAAGCGGCTCGTGCTGCAGTCTCCGCGTCTG
CGGACGTTGCACTACCGCGACCTGGGCATCGGCACCAGCTTCCGTTTCGGCCGCTCGGAGCGGCTGCCGGCCGTC
GTCGACCTCGTGCTCCAGTCGTACAACTGGGATCACTCGACGGACGAGGTCGGACGGCACTGGGACTTTTCGCGG
ATCCGGTCCCTGGAGCTGGTCAACATGCCCGTGGCCAACTTTTTGGCGTCGGTCCGGCTCCGTGACTTTGCGCGC
CTTCACACGCTCCGGGTCGAGGACTACGGGGGCCACCTGCAGGACACGCGGCCGAGTGCGACGGTGCAACTGTGC
GAGCTGGTGCGGGACCACGTCGAGGCGCTCGAGACGCTCGACATTACCTGCCACACCCGGCTCTTCGAGCTCGAG
GCGATAGGGAAACACCGCCACTCACTGCGGGTGCTCCGGTACCGGGATCACGTCGGCTTCGAGGACGACAGCAAG
CGGTGCCCGACGCTGGGGCGGGCGGAGCTGAGGGCGCTGGGGCATCGCCTGGGACACGTGCACACGCTGGAGCTG
GACATGGACGCGGCACCGGACGACTTGGTCGAGGCCGTGTGCTCGTTCGCGCGGCTGCACACGCTGACGCTACAC
GTGCAGACGCAGATCCGAGCGTGCGACCCGGTAGAGCCGGACCGGGATCGGGACCGCGAGGCGGCGCTCGACGTG
TTCGGCCGGCTGATCGGACGGCGGGCGTGGCGGCGGGTGATGATCAACGTGGGCGGGTGGCGAAGGGCCATGGTG
CGGCGGATGGGATACGAGTGGAAACGGCACAACGAGCAGGGCGTATACGCCGAGCGGTGCTTTTGGCTCGAGAGG
GATCAGAAGGGCTACAGCGTGGGCGAGGAGGCGGCGCTTGGGGGGGGCCCTATGCCGGCCATCGCGGGCTCTATG
CTTGGGCTCTGA
Gene >Ophio5|823
ATGGAGCTGACATGTCCCGAAGAGACGAGTCCGCTGGCCGTTCTGTGTCCGGAGATTCTGACGCTAATCATAGAC
GATGTAAGCCTCGCTGGGCCCCGGCACCGCCCAGGCAAGCTGACTGTAGTCACGCTAGTTGCGAGCTCTCGATCA
CAGGTCCGTCTTCATCGTGCGTCTTGCCTGCCGTATCTTGAACTCGGCGGCGACGCCGGTCGCCTACCGTGCCAT
CCACCTCAACCGTGGCATACTCAACCCTTGCGCGGGGCGTCTATACCCCCGCCTGCTCGAGCACGTATCCCGCTT
CACGCACGAAGTGACGGTTCGCAGCGACCTGCCGTCGACGGACGTCCGACGAGTCCTGTCCGGCATCAAGCGGTT
GTCATTCGTCAGGTGCGCCATAACGCCGAGGGACGACGACATCGGGAGGAGGAGGGGGTTTGCTGACGGCCCCGT
AGGTGGTCCTATGTGGCCCCAGATGTAGTCGGCTCTTCCAGCCTGCGGTTGCCCTGGGACATTCTGGACGCCGAA
CAGGTGGAGCGCAGCGGTATCCGCGTCGCCGTCGAGAACCTGCCGCTGGGAGGGGTGCACTGCGACCTGGACGAG
TCGTGCTTCAGACCGGCCCTCACGCGGCGCATGGTATCGCTGAAGCTGTCGAGTCCGAAGCCGCCGTTGACGACT
CGGAGCGGCTCGCTCAAGCGGCTCGTGCTGCAGTCTCCGCGTCTGCGGACGTTGCACTACCGCGACCTGGGCATC
GGCACCAGCTTCCGTTTCGGCCGCTCGGAGCGGCTGCCGGCCGTCGTCGACCTCGTGCTCCAGTCGTACAACTGG
GATCACTCGACGGACGAGGTCGGACGGCACTGGGACTTTTCGCGGATCCGGTCCCTGGAGCTGGTCAACATGCCC
GTGGCCAACTTTTTGGCGTCGGTCCGGCTCCGTGACTTTGCGCGCCTTCACACGCTCCGGGTCGAGGACTACGGG
GGCCACCTGCAGGACACGCGGCCGAGTGCGACGGTGCAACTGTGCGAGCTGGTGCGGGACCACGTCGAGGCGCTC
GAGACGCTCGACATTACCTGCCACACCCGGCTCTTCGAGCTCGAGGCGATAGGGAAACACCGCCACTCACTGCGG
GTGCTCCGGTACCGGGATCACGTCGGCTTCGAGGACGACAGCAAGCGGTGCCCGACGCTGGGGCGGGCGGAGCTG
AGGGCGCTGGGGCATCGCCTGGGACACGTGCACACGCTGGAGCTGGACATGGACGCGGCACCGGACGACTTGGTC
GAGGCCGTGTGCTCGTTCGCGCGGCTGCACACGCTGACGCTACACGTGCAGACGCAGATCCGAGCGTGCGACCCG
GTAGAGCCGGACCGGGATCGGGACCGCGAGGCGGCGCTCGACGTGTTCGGCCGGCTGATCGGACGGCGGGCGTGG
CGGCGGGTGATGATCAACGTGGGCGGGTGGCGAAGGGCCATGGTGCGGCGGATGGGATACGAGTGGAAACGGCAC
AACGAGCAGGGCGTATACGCCGAGCGGTGCTTTTGGCTCGAGAGGGATCAGAAGGGCTACAGCGTGGGCGAGGAG
GCGGCGCTTGGGGGGGGCCCTATGCCGGCCATCGCGGGCTCTATGCTTGGGCTCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail