Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8222
Gene name
Locationscaffold_89:12748..14342
Strand+
Gene length (bp)1594
Transcript length (bp)1209
Coding sequence length (bp)1206
Protein length (aa) 402

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05653 Mg_trans_NIPA Magnesium transporter NIPA 6.2E-100 4 293

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q94AH3|NIPA4_ARATH Probable magnesium transporter NIPA4 OS=Arabidopsis thaliana GN=At1g71900 PE=2 SV=1 1 322 2.0E-93
sp|Q9LNK7|NIPA3_ARATH Probable magnesium transporter NIPA3 OS=Arabidopsis thaliana GN=At1g34470 PE=2 SV=1 1 293 5.0E-92
sp|F4JKQ7|NIPA5_ARATH Probable magnesium transporter NIPA5 OS=Arabidopsis thaliana GN=At4g09640 PE=2 SV=1 1 290 3.0E-87
sp|Q8GYS1|NIPA7_ARATH Probable magnesium transporter NIPA7 OS=Arabidopsis thaliana GN=At4g38730 PE=2 SV=1 1 298 2.0E-86
sp|Q8GWX2|NIPA6_ARATH Probable magnesium transporter NIPA6 OS=Arabidopsis thaliana GN=At2g21120 PE=2 SV=1 1 311 2.0E-86
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q94AH3|NIPA4_ARATH Probable magnesium transporter NIPA4 OS=Arabidopsis thaliana GN=At1g71900 PE=2 SV=1 1 322 2.0E-93
sp|Q9LNK7|NIPA3_ARATH Probable magnesium transporter NIPA3 OS=Arabidopsis thaliana GN=At1g34470 PE=2 SV=1 1 293 5.0E-92
sp|F4JKQ7|NIPA5_ARATH Probable magnesium transporter NIPA5 OS=Arabidopsis thaliana GN=At4g09640 PE=2 SV=1 1 290 3.0E-87
sp|Q8GYS1|NIPA7_ARATH Probable magnesium transporter NIPA7 OS=Arabidopsis thaliana GN=At4g38730 PE=2 SV=1 1 298 2.0E-86
sp|Q8GWX2|NIPA6_ARATH Probable magnesium transporter NIPA6 OS=Arabidopsis thaliana GN=At2g21120 PE=2 SV=1 1 311 2.0E-86
sp|B3LFA3|NIPA2_ARATH Probable magnesium transporter NIPA2 OS=Arabidopsis thaliana GN=At4g13800 PE=2 SV=1 1 298 9.0E-82
sp|Q5R7Q3|NIPA2_PONAB Magnesium transporter NIPA2 OS=Pongo abelii GN=NIPA2 PE=2 SV=1 4 290 8.0E-81
sp|Q8N8Q9|NIPA2_HUMAN Magnesium transporter NIPA2 OS=Homo sapiens GN=NIPA2 PE=2 SV=1 4 290 8.0E-81
sp|Q3SWX0|NIPA2_BOVIN Magnesium transporter NIPA2 OS=Bos taurus GN=NIPA2 PE=2 SV=1 4 290 3.0E-80
sp|Q9JJC8|NIPA2_MOUSE Magnesium transporter NIPA2 OS=Mus musculus GN=Nipa2 PE=1 SV=1 4 290 4.0E-80
sp|Q9LIR9|NIPA1_ARATH Probable magnesium transporter NIPA1 OS=Arabidopsis thaliana GN=At3g23870 PE=2 SV=1 43 313 2.0E-79
sp|Q8BZF2|NIPA4_MOUSE Magnesium transporter NIPA4 OS=Mus musculus GN=Nipal4 PE=1 SV=1 6 305 6.0E-75
sp|Q0D2K0|NIPA4_HUMAN Magnesium transporter NIPA4 OS=Homo sapiens GN=NIPAL4 PE=1 SV=3 6 290 2.0E-70
sp|Q8BMW7|NIPA3_MOUSE Magnesium transporter NIPA3 OS=Mus musculus GN=Nipal1 PE=1 SV=2 2 290 1.0E-58
sp|Q7RTP0|NIPA1_HUMAN Magnesium transporter NIPA1 OS=Homo sapiens GN=NIPA1 PE=1 SV=1 7 293 2.0E-54
sp|Q8BHK1|NIPA1_MOUSE Magnesium transporter NIPA1 OS=Mus musculus GN=Nipa1 PE=1 SV=1 7 293 5.0E-54
sp|Q5RDB8|NIPA3_PONAB Magnesium transporter NIPA3 OS=Pongo abelii GN=NIPAL1 PE=2 SV=1 2 290 1.0E-53
sp|Q6NVV3|NIPA3_HUMAN Magnesium transporter NIPA3 OS=Homo sapiens GN=NIPAL1 PE=2 SV=1 2 290 8.0E-53
sp|Q9H841|NPAL2_HUMAN NIPA-like protein 2 OS=Homo sapiens GN=NIPAL2 PE=2 SV=1 8 313 2.0E-27
sp|Q6P499|NPAL3_HUMAN NIPA-like protein 3 OS=Homo sapiens GN=NIPAL3 PE=1 SV=1 3 313 8.0E-27
sp|Q5RD30|NPAL3_PONAB NIPA-like protein 3 OS=Pongo abelii GN=NIPAL3 PE=2 SV=1 3 313 1.0E-25
sp|Q91WC7|NPAL2_MOUSE NIPA-like protein 2 OS=Mus musculus GN=Nipal2 PE=2 SV=1 8 295 7.0E-23
sp|Q8BGN5|NPAL3_MOUSE NIPA-like protein 3 OS=Mus musculus GN=Nipal3 PE=2 SV=1 3 313 8.0E-23
sp|Q8RWF4|NIPA8_ARATH Probable magnesium transporter NIPA8 OS=Arabidopsis thaliana GN=At3g26670 PE=2 SV=1 47 344 4.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0015095 magnesium ion transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0015693 magnesium ion transport Yes
GO:0110165 cellular anatomical entity No
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No
GO:0030001 metal ion transport No
GO:0005575 cellular_component No
GO:0046873 metal ion transmembrane transporter activity No
GO:0008324 cation transmembrane transporter activity No
GO:0006811 ion transport No
GO:0006812 cation transport No
GO:0015318 inorganic molecular entity transmembrane transporter activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Lysosome/Vacuole Signal peptide|Transmembrane domain 0.1075 0.1236 0.0224 0.4144 0.0648 0.0013 0.2466 0.6202 0.5442 0.0065

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 7 26 19
2 75 97 22
3 104 123 19
4 138 160 22
5 173 195 22
6 210 229 19
7 242 264 22
8 269 291 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4994
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6968
Ophiocordyceps australis map64 (Brazil) OphauB2|6929
Ophiocordyceps camponoti-floridani Ophcf2|01869
Ophiocordyceps camponoti-rufipedis Ophun1|6289
Ophiocordyceps kimflemingae Ophio5|8222 (this protein)
Ophiocordyceps subramaniannii Hirsu2|2335

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8222
MIEDKYIGLALAMSSALAIGTSFVITKKGLLDAEQRHGFEGDGFVYLRSPVWWAGIATLVIGEVCNFAAYAFAPA
ILVTPLGALSVLIGAVLGSYFLEEELGTLGKLGSAICLIGAVVIVLHAPPDEDIQTIDQILHYAIQPGFLLYAVA
VIAFAAFMIYKIAPVYGKKNALIYLSICSTVGSISVMSVKAFGIALKLSLAGNNQFSHPSTYVFMILTTVCILIQ
MNYFNKALASFPTYIVNPLYYVTFTTATLCASFILFSGFNTTDAVNTLSLLCGFLVTFTGVYLLNLSRSDPNAHN
VPAGHIMAHDSTPTDMVSSLQTRRSMQSRRSGDHARHSVSSLHGDREGLIRAYDEEEAAGFGLTDLAEESEDDSQ
KSNSRLNGKKEVNSGDIELEDRKSAER
Coding >Ophio5|8222
ATGATCGAAGACAAGTACATCGGCCTAGCGCTGGCCATGTCCTCGGCTCTCGCTATCGGCACCAGTTTCGTCATC
ACGAAAAAGGGATTGCTAGACGCCGAGCAACGACACGGCTTCGAGGGCGACGGTTTTGTCTACCTGAGGAGTCCC
GTGTGGTGGGCTGGCATCGCCACACTCGTCATCGGAGAAGTTTGCAACTTCGCCGCCTACGCGTTCGCACCAGCC
ATTCTCGTCACGCCTCTCGGGGCGCTTAGTGTTCTCATCGGCGCCGTCCTCGGCTCCTACTTTCTCGAGGAGGAG
CTGGGGACCCTGGGCAAGCTGGGGAGTGCCATCTGCCTCATCGGCGCCGTCGTTATCGTCCTCCACGCGCCCCCC
GACGAAGACATTCAGACTATTGATCAAATCTTGCACTACGCCATCCAGCCAGGTTTCCTGCTCTACGCCGTTGCC
GTCATTGCCTTTGCGGCCTTTATGATCTACAAGATCGCGCCTGTCTATGGCAAGAAGAACGCCCTCATCTACCTT
TCCATTTGTTCGACCGTCGGCTCCATCTCCGTCATGTCTGTCAAGGCTTTTGGTATCGCCCTCAAGCTCTCCCTG
GCCGGCAACAACCAGTTTTCTCACCCGTCCACCTACGTCTTCATGATATTGACCACCGTCTGCATTCTCATTCAG
ATGAACTACTTCAATAAGGCGCTGGCGTCCTTTCCTACCTATATTGTCAACCCCCTGTACTACGTGACCTTTACG
ACGGCCACCCTGTGTGCGTCCTTCATCCTCTTCAGCGGCTTCAACACCACCGACGCCGTCAACACCCTGTCGTTG
CTCTGCGGCTTCCTCGTCACCTTTACCGGTGTCTACTTGCTCAACCTGTCAAGAAGCGATCCAAACGCGCACAAC
GTCCCTGCAGGACACATTATGGCCCACGACTCGACGCCGACCGATATGGTGTCCAGTTTGCAGACTCGCCGCAGC
ATGCAATCTCGTCGCAGCGGCGATCACGCACGGCACAGCGTGAGCAGTCTGCATGGCGACAGGGAAGGCCTGATC
CGGGCATACGACGAGGAGGAGGCTGCGGGTTTCGGCCTCACTGACCTGGCGGAGGAGAGCGAAGACGATTCGCAG
AAATCAAACAGCCGCTTGAACGGCAAGAAAGAGGTCAACTCGGGCGACATCGAGCTGGAGGACCGGAAATCTGCT
GAGAGG
Transcript >Ophio5|8222
ATGATCGAAGACAAGTACATCGGCCTAGCGCTGGCCATGTCCTCGGCTCTCGCTATCGGCACCAGTTTCGTCATC
ACGAAAAAGGGATTGCTAGACGCCGAGCAACGACACGGCTTCGAGGGCGACGGTTTTGTCTACCTGAGGAGTCCC
GTGTGGTGGGCTGGCATCGCCACACTCGTCATCGGAGAAGTTTGCAACTTCGCCGCCTACGCGTTCGCACCAGCC
ATTCTCGTCACGCCTCTCGGGGCGCTTAGTGTTCTCATCGGCGCCGTCCTCGGCTCCTACTTTCTCGAGGAGGAG
CTGGGGACCCTGGGCAAGCTGGGGAGTGCCATCTGCCTCATCGGCGCCGTCGTTATCGTCCTCCACGCGCCCCCC
GACGAAGACATTCAGACTATTGATCAAATCTTGCACTACGCCATCCAGCCAGGTTTCCTGCTCTACGCCGTTGCC
GTCATTGCCTTTGCGGCCTTTATGATCTACAAGATCGCGCCTGTCTATGGCAAGAAGAACGCCCTCATCTACCTT
TCCATTTGTTCGACCGTCGGCTCCATCTCCGTCATGTCTGTCAAGGCTTTTGGTATCGCCCTCAAGCTCTCCCTG
GCCGGCAACAACCAGTTTTCTCACCCGTCCACCTACGTCTTCATGATATTGACCACCGTCTGCATTCTCATTCAG
ATGAACTACTTCAATAAGGCGCTGGCGTCCTTTCCTACCTATATTGTCAACCCCCTGTACTACGTGACCTTTACG
ACGGCCACCCTGTGTGCGTCCTTCATCCTCTTCAGCGGCTTCAACACCACCGACGCCGTCAACACCCTGTCGTTG
CTCTGCGGCTTCCTCGTCACCTTTACCGGTGTCTACTTGCTCAACCTGTCAAGAAGCGATCCAAACGCGCACAAC
GTCCCTGCAGGACACATTATGGCCCACGACTCGACGCCGACCGATATGGTGTCCAGTTTGCAGACTCGCCGCAGC
ATGCAATCTCGTCGCAGCGGCGATCACGCACGGCACAGCGTGAGCAGTCTGCATGGCGACAGGGAAGGCCTGATC
CGGGCATACGACGAGGAGGAGGCTGCGGGTTTCGGCCTCACTGACCTGGCGGAGGAGAGCGAAGACGATTCGCAG
AAATCAAACAGCCGCTTGAACGGCAAGAAAGAGGTCAACTCGGGCGACATCGAGCTGGAGGACCGGAAATCTGCT
GAGAGGTAG
Gene >Ophio5|8222
ATGATCGAAGACAAGTACGTCGCGCCTCCCGCTTCTTTCCATCACGACTCGATGCGCCGCGTGGACGGGACGCCT
CCTTGCTGACCAGCCTCTTCTTCCAGGTACATCGGCCTAGCGCTGGCCATGTCCTCGGCTCTCGCTATCGGTAAG
ATAGATGATTACTCGCCGCTGCCCTGTGCGCACCTCTTTTGCTAACAAGGCCTTTCAGGCACCAGTTTCGTCATC
ACGAAAAAGGTTCGTCGCTGCCGCCTTGCCTCACATTCTCACGTCCCTCCGACCGTCCCCATCGCGATTCTAACA
TGTGGCTTTAGGGATTGCTAGACGCCGAGCAACGACACGGCTTCGAGGGCGACGGTTTTGTCTACCTGAGGAGTC
CCGTGTGGTGGGCTGGCATCGCCACACGTGAGTATCTTCGTCTTGTTGTCGATACTGTCGGGCTGACATTTCCTG
TCCATCTAGTCGTCATCGGAGAAGTTTGCAACTTCGCCGCCTACGCGTTCGCACCAGCCATTCTCGTCACGCCTC
TCGGGGCGCTTAGTGTTCTCATCGGCGCCGTCCTCGGCTCCTACTTTCTCGAGGAGGAGCTGGGGACCCTGGGCA
AGCTGGGGAGTGCCATCTGCCTCATCGGCGCCGTCGTTATCGTCCTCCACGCGCCCCCCGACGAAGACATTCAGA
CTATTGATCAAATCTTGCACTACGCCATCCAGCCAGGTACGAGCCCTGTTCGTGTCGCGCCGATTGGTCTGACCA
GTCCATAGGTTTCCTGCTCTACGCCGTTGCCGTCATTGCCTTTGCGGCCTTTATGATCTACAAGATCGCGCCTGT
CTATGGCAAGAAGAACGCCCTCATCTACCTTTCCATTTGTTCGACCGTCGGCTCCATCTCCGTCATGTCTGTCAA
GGCTTTTGGTATCGCCCTCAAGCTCTCCCTGGCCGGCAACAACCAGTTTTCTCACCCGTCCACCTACGTCTTCAT
GATATTGACCACCGTCTGCATTCTCATTCAGATGAACTACTTCAATAAGGCGCTGGCGTCCTTTCCTACCTATAT
GTCAGTCTCTCTCTCTCTCTACCGTTCGCGGCTTTGGACGCTGACTCTCCGAAGTGTCAACCCCCTGTACTACGT
GACCTTTACGACGGCCACCCTGTGTGCGTCCTTCATCCTCTTCAGCGGCTTCAACACCACCGACGCCGTCAACAC
CCTGTCGTTGCTCTGCGGCTTCCTCGTCACCTTTACCGGTGTCTACTTGCTCAACCTGTCAAGAAGCGATCCAAA
CGCGCACAACGTCCCTGCAGGACACATTATGGCCCACGACTCGACGCCGACCGATATGGTGTCCAGTTTGCAGAC
TCGCCGCAGCATGCAATCTCGTCGCAGCGGCGATCACGCACGGCACAGCGTGAGCAGTCTGCATGGCGACAGGGA
AGGCCTGATCCGGGCATACGACGAGGAGGAGGCTGCGGGTTTCGGCCTCACTGACCTGGCGGAGGAGAGCGAAGA
CGATTCGCAGAAATCAAACAGCCGCTTGAACGGCAAGAAAGAGGTCAACTCGGGCGACATCGAGCTGGAGGACCG
GAAATCTGCTGAGAGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail