Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8218
Gene name
Locationscaffold_89:1666..4258
Strand-
Gene length (bp)2592
Transcript length (bp)2241
Coding sequence length (bp)2238
Protein length (aa) 746

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12896 ANAPC4 Anaphase-promoting complex, cyclosome, subunit 4 1.3E-68 263 464
PF12894 ANAPC4_WD40 Anaphase-promoting complex subunit 4 WD40 domain 7.8E-10 27 121

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O42839|APC4_SCHPO Anaphase-promoting complex subunit 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cut20 PE=1 SV=2 11 499 3.0E-18
sp|Q9UJX5|APC4_HUMAN Anaphase-promoting complex subunit 4 OS=Homo sapiens GN=ANAPC4 PE=1 SV=2 61 492 2.0E-12
sp|Q5RAQ5|APC4_PONAB Anaphase-promoting complex subunit 4 OS=Pongo abelii GN=ANAPC4 PE=2 SV=1 61 492 4.0E-12
sp|Q91W96|APC4_MOUSE Anaphase-promoting complex subunit 4 OS=Mus musculus GN=Anapc4 PE=1 SV=1 61 492 1.0E-11

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8218
MAHPKQLVLFSETELDSRAPRGFPVGCPTLDVASTWDSGSRSLVVYRPPGQVISKVHQLGGQGEMAPEAVAVTWS
PDGQFLAVGWSDGVVRLMRLENNKVAHRIPPCQGKTGAQITYIGWTGSNMPKQAFKSTTNLPAGHVNLPQALAFL
DVDPALPKMSPLPSGSAGADEDANLFTLRAGVDLLFQPPKQGEHDTVNVMVVGTSQGDVQLSIYDSFVIGTFQCP
AVGASNASQLIHHASHPDVSTHALILAEKVTEPCEVQLLPMDLPFISSSPINLSLLASKLTTLQKLLRYLKQTQL
HMQIEWRNARELPARFLRGIQGDLEELQRGPRHIVPALYHTVVTGHAYEPVREWLVDTLTERGHKRWEKAVVSGL
ENLRSLVHENFLPALERCALIFSRLRGLAQFHDDRDDIGFSVSQISRVLDIIGCLHLVGHKILIHVMDELEHFAA
FSVWLRFQIDGLASGTSEELTEKEATMDTSRVLTYIETYLTQSPLDMFFDEISTQDCTADWEHCEVGPSLLQMLD
IQLKKREDGQPSMRALPHVDFLVNYMTTWSGRIFKSVAESMKRSVRFGKPIAMSVGAPISKMDVKVGKAGKGGVI
YTAVACKDSETQVYILRAEMDIVNGISRNLPPTGCCVDLGNRQLIDAKFLNDETLVVLCKENDLSSVALSIPIQS
SELPYAPLDAGGLKDVGTAPVDSFVRHLVPEQQPTRPVRMEVHDKSEAKGQIPERICLLSSNQTTWRTYCM
Coding >Ophio5|8218
ATGGCCCATCCGAAGCAGCTCGTGCTCTTCAGCGAGACAGAGCTCGACTCCCGAGCTCCTCGTGGCTTTCCCGTC
GGCTGTCCGACGCTGGACGTGGCCTCGACCTGGGACAGCGGCAGCAGGAGCCTCGTCGTCTATAGGCCTCCAGGC
CAAGTGATATCCAAGGTGCACCAACTCGGCGGCCAAGGAGAAATGGCGCCGGAAGCCGTTGCGGTGACGTGGAGT
CCGGACGGGCAGTTCCTGGCCGTGGGTTGGAGCGATGGCGTCGTACGGCTCATGAGGCTGGAAAACAACAAGGTG
GCCCATCGCATCCCGCCATGTCAGGGGAAAACAGGGGCACAAATCACCTACATCGGCTGGACAGGCAGCAACATG
CCCAAGCAGGCCTTCAAGTCGACCACCAACTTACCGGCCGGTCATGTCAACCTCCCTCAGGCCCTCGCCTTTCTC
GACGTTGACCCGGCCTTGCCCAAGATGAGCCCCCTGCCAAGCGGCAGTGCTGGCGCCGACGAGGATGCCAACCTC
TTTACTCTGCGCGCCGGCGTCGACCTCCTCTTCCAGCCTCCCAAACAGGGAGAGCACGACACGGTCAACGTCATG
GTAGTGGGAACCAGCCAAGGCGACGTGCAGCTGAGCATCTACGACTCCTTCGTCATCGGCACTTTTCAGTGCCCG
GCTGTGGGCGCCTCCAACGCCTCCCAACTGATTCATCATGCATCCCACCCTGACGTCTCGACCCACGCCCTAATC
CTGGCAGAAAAGGTGACGGAACCATGCGAGGTCCAGCTATTACCCATGGACCTACCCTTCATATCATCTTCGCCC
ATTAACCTGTCCCTGCTGGCTTCCAAGTTGACTACGCTGCAGAAGCTCCTGCGGTACCTGAAGCAGACGCAACTA
CATATGCAGATCGAATGGCGAAACGCGAGAGAGTTGCCGGCTCGCTTCCTGCGAGGCATCCAGGGCGACCTCGAG
GAGTTGCAACGCGGACCACGCCATATAGTCCCCGCTCTGTATCATACGGTCGTGACGGGCCACGCCTACGAGCCG
GTTCGCGAATGGCTCGTCGACACTCTTACAGAACGAGGTCATAAACGCTGGGAAAAGGCCGTTGTATCCGGTCTC
GAAAATTTGCGCAGCCTCGTCCACGAAAACTTCCTCCCGGCCCTTGAGCGCTGCGCCCTCATCTTCAGCAGGCTT
CGTGGACTTGCTCAATTCCACGACGACCGCGATGACATTGGCTTCTCCGTGTCCCAGATCAGCCGAGTCTTGGAC
ATCATCGGCTGTCTACACCTCGTCGGCCACAAGATTCTCATTCACGTCATGGACGAGCTGGAGCACTTTGCAGCT
TTTTCCGTCTGGTTGCGCTTTCAGATCGATGGTCTAGCCAGCGGCACGAGCGAAGAACTCACGGAAAAGGAGGCC
ACAATGGACACGTCTAGGGTCCTCACATATATCGAAACATACCTCACCCAAAGTCCGCTCGACATGTTCTTCGAC
GAAATCTCGACCCAAGACTGCACGGCCGACTGGGAGCATTGCGAGGTCGGACCCAGCTTGCTACAGATGCTGGAC
ATACAGCTTAAGAAGCGGGAAGATGGGCAACCCAGTATGAGGGCCCTGCCTCACGTCGACTTCCTCGTCAACTAC
ATGACGACGTGGAGCGGCAGGATCTTCAAGAGCGTCGCCGAGTCCATGAAGAGGAGCGTGCGGTTTGGAAAGCCC
ATTGCAATGTCGGTGGGCGCCCCGATCAGCAAGATGGACGTCAAAGTCGGCAAAGCGGGAAAGGGGGGCGTCATC
TACACCGCCGTGGCATGCAAAGATTCCGAGACTCAAGTGTACATTTTGCGTGCCGAGATGGACATTGTCAACGGC
ATCAGCCGCAACTTGCCACCGACGGGCTGCTGCGTTGATCTCGGCAACCGCCAGCTCATCGACGCCAAGTTCCTC
AACGACGAAACCCTCGTGGTGCTTTGCAAAGAAAATGACCTCTCGTCAGTCGCCCTGTCAATACCGATTCAGTCG
AGTGAGCTGCCCTACGCTCCGCTGGATGCCGGGGGGCTCAAGGATGTCGGCACCGCTCCAGTAGACAGCTTCGTC
AGGCATCTGGTCCCCGAGCAGCAGCCTACGAGGCCGGTGAGGATGGAGGTACACGATAAGAGTGAGGCCAAGGGG
CAGATTCCCGAGAGGATTTGTCTCCTCAGCAGCAACCAAACAACATGGCGAACGTACTGCATG
Transcript >Ophio5|8218
ATGGCCCATCCGAAGCAGCTCGTGCTCTTCAGCGAGACAGAGCTCGACTCCCGAGCTCCTCGTGGCTTTCCCGTC
GGCTGTCCGACGCTGGACGTGGCCTCGACCTGGGACAGCGGCAGCAGGAGCCTCGTCGTCTATAGGCCTCCAGGC
CAAGTGATATCCAAGGTGCACCAACTCGGCGGCCAAGGAGAAATGGCGCCGGAAGCCGTTGCGGTGACGTGGAGT
CCGGACGGGCAGTTCCTGGCCGTGGGTTGGAGCGATGGCGTCGTACGGCTCATGAGGCTGGAAAACAACAAGGTG
GCCCATCGCATCCCGCCATGTCAGGGGAAAACAGGGGCACAAATCACCTACATCGGCTGGACAGGCAGCAACATG
CCCAAGCAGGCCTTCAAGTCGACCACCAACTTACCGGCCGGTCATGTCAACCTCCCTCAGGCCCTCGCCTTTCTC
GACGTTGACCCGGCCTTGCCCAAGATGAGCCCCCTGCCAAGCGGCAGTGCTGGCGCCGACGAGGATGCCAACCTC
TTTACTCTGCGCGCCGGCGTCGACCTCCTCTTCCAGCCTCCCAAACAGGGAGAGCACGACACGGTCAACGTCATG
GTAGTGGGAACCAGCCAAGGCGACGTGCAGCTGAGCATCTACGACTCCTTCGTCATCGGCACTTTTCAGTGCCCG
GCTGTGGGCGCCTCCAACGCCTCCCAACTGATTCATCATGCATCCCACCCTGACGTCTCGACCCACGCCCTAATC
CTGGCAGAAAAGGTGACGGAACCATGCGAGGTCCAGCTATTACCCATGGACCTACCCTTCATATCATCTTCGCCC
ATTAACCTGTCCCTGCTGGCTTCCAAGTTGACTACGCTGCAGAAGCTCCTGCGGTACCTGAAGCAGACGCAACTA
CATATGCAGATCGAATGGCGAAACGCGAGAGAGTTGCCGGCTCGCTTCCTGCGAGGCATCCAGGGCGACCTCGAG
GAGTTGCAACGCGGACCACGCCATATAGTCCCCGCTCTGTATCATACGGTCGTGACGGGCCACGCCTACGAGCCG
GTTCGCGAATGGCTCGTCGACACTCTTACAGAACGAGGTCATAAACGCTGGGAAAAGGCCGTTGTATCCGGTCTC
GAAAATTTGCGCAGCCTCGTCCACGAAAACTTCCTCCCGGCCCTTGAGCGCTGCGCCCTCATCTTCAGCAGGCTT
CGTGGACTTGCTCAATTCCACGACGACCGCGATGACATTGGCTTCTCCGTGTCCCAGATCAGCCGAGTCTTGGAC
ATCATCGGCTGTCTACACCTCGTCGGCCACAAGATTCTCATTCACGTCATGGACGAGCTGGAGCACTTTGCAGCT
TTTTCCGTCTGGTTGCGCTTTCAGATCGATGGTCTAGCCAGCGGCACGAGCGAAGAACTCACGGAAAAGGAGGCC
ACAATGGACACGTCTAGGGTCCTCACATATATCGAAACATACCTCACCCAAAGTCCGCTCGACATGTTCTTCGAC
GAAATCTCGACCCAAGACTGCACGGCCGACTGGGAGCATTGCGAGGTCGGACCCAGCTTGCTACAGATGCTGGAC
ATACAGCTTAAGAAGCGGGAAGATGGGCAACCCAGTATGAGGGCCCTGCCTCACGTCGACTTCCTCGTCAACTAC
ATGACGACGTGGAGCGGCAGGATCTTCAAGAGCGTCGCCGAGTCCATGAAGAGGAGCGTGCGGTTTGGAAAGCCC
ATTGCAATGTCGGTGGGCGCCCCGATCAGCAAGATGGACGTCAAAGTCGGCAAAGCGGGAAAGGGGGGCGTCATC
TACACCGCCGTGGCATGCAAAGATTCCGAGACTCAAGTGTACATTTTGCGTGCCGAGATGGACATTGTCAACGGC
ATCAGCCGCAACTTGCCACCGACGGGCTGCTGCGTTGATCTCGGCAACCGCCAGCTCATCGACGCCAAGTTCCTC
AACGACGAAACCCTCGTGGTGCTTTGCAAAGAAAATGACCTCTCGTCAGTCGCCCTGTCAATACCGATTCAGTCG
AGTGAGCTGCCCTACGCTCCGCTGGATGCCGGGGGGCTCAAGGATGTCGGCACCGCTCCAGTAGACAGCTTCGTC
AGGCATCTGGTCCCCGAGCAGCAGCCTACGAGGCCGGTGAGGATGGAGGTACACGATAAGAGTGAGGCCAAGGGG
CAGATTCCCGAGAGGATTTGTCTCCTCAGCAGCAACCAAACAACATGGCGAACGTACTGCATGTGA
Gene >Ophio5|8218
ATGGCCCATCCGAAGCAGCTCGTGCTCTTCAGCGAGACAGAGCTCGACTCCCGAGCTCCTCGTGGCTTTCCCGTC
GGCTGTCCGACGCTGGACGTGGCCTCGACCTGGGACAGCGGCAGCAGGAGCCTCGTCGTCTATAGGCCTCCAGGC
CAAGTGATATCCAAGGTGCACCAACTCGGCGGCCAAGGAGAAATGGCGCCGGAAGCCGTTGCGGTGACGTGGAGT
CCGGACGGTTCGTTTGACTGCAAACGCATGCGTGACAAGACGACTGAAAGTACAGACCTTCAGGGCAGTTCCTGG
CCGTGGGTTGGAGCGATGGCGTCGTACGGCTCATGAGGCTGGAAAACAACAAGGTGGCCCATCGCATCCCGCCAT
GTCAGGGGAAAACAGGGGCACAAATCACCTACATCGGCTGGACAGGCAGCAACATGCCCAAGCAGGCCTTCAAGT
CGACCACCAACTTACCGGCCGGTCATGTCAACCTCCCTCAGGCCCTCGCCTTTCTCGACGTTGACCCGGCCTTGC
CCAAGATGAGCCCCCTGCCAAGCGGCAGTGCTGGCGCCGAGTGAGCCTCAAGAGCATCCACCATATTCCTGGGCA
GAGATGCTGACTCCGACGCCCAGCGAGGATGCCAACCTCTTTACTCTGCGCGCCGGCGTCGACCTCCTCTTCCAG
CCTCCCAAACAGGGAGAGCACGACACGGTCAACGTCATGGTAGTGGGAACCAGCCAAGGCGACGTGCAGCTGAGC
ATCTACGACTCCTTCGTCATCGGCACTTTTCAGTGCCCGGCTGTGGGCGCCTCCAACGCCTCCCAACTGATTCAT
CATGCATCCCACCCTGACGTCTCGACCCACGCCCTAATCCTGGCAGAAAAGGTGACGGAACCATGCGAGGTCCAG
CTATTACCCATGGACCTACCCTTCATATCATCTTCGCCCATTAACCTGTCCCTGCTGGCTTCCAAGTTGACTACG
CTGCAGAAGCTCCTGCGGTACCTGAAGCAGACGCAACTACATATGCAGATCGAATGGCGAAACGCGAGAGAGTTG
CCGGCTCGCTTCCTGCGAGGCATCCAGGGCGACCTCGAGGAGTTGCAACGCGGACCACGCCATATAGTCCCCGCT
CTGTATCATACGGTCGTGACGGGCCACGCCTACGAGCCGGTTCGCGAATGGCTCGTCGACACTCTTACAGAACGA
GTAAGTCGAGTCTGATACTGTCCGGTGCGTCTCCCTGCTGACAGGGCATCGCCGCAGGGTCATAAACGCTGGGAA
AAGGCCGTTGTATCCGGTCTCGAAAATTTGCGCAGCCTCGTCCACGAAAACTTCCTCCCGGCCCTTGAGCGCTGC
GCCCTCATCTTCAGCAGGCTTCGTGGACTTGCTCAATTCCACGACGACCGCGATGACATTGGCTTCTCCGTGTCC
CAGATCAGCCGAGTCTTGGACATCATCGGCTGTCTACACCTCGTCGGCCACAAGATTCTCATTCACGTCATGGAC
GAGCTGGAGCACTTTGCAGCTTTTTCCGTCTGGTTGCGCTTTCAGATCGATGGTCTAGCCAGCGGCACGAGCGAA
GAACTCACGGAAAAGGAGGCCACAATGGACACGTCTAGGGTCCTCACATATATCGAAACATACCTCACCCAAAGT
CCGCTCGACATGTTCTTCGACGAAATCTCGACCCAAGACTGCACGGCCGACTGGGAGCATTGCGAGGTCGGACCC
AGCTTGCTACAGATGCTGGACATACAGCTTAAGAAGCGGGAAGATGGGCAACCCAGTATGAGGGCCCTGCCTCAC
GTCGACTTCCTCGTCAACTACATGACGACGTGGAGCGGCAGGATCTTCAAGAGCGTCGCCGAGTCCATGAAGAGG
AGCGTGCGGTTTGGAAAGCCCATTGCAATGTCGGTGGGCGCCCCGATCAGCAAGATGGACGTCAAAGTCGGCAAA
GCGGGAAAGGTACGTCCGATGTGCTTGGCTCTCCTTCTATCCACTGCCTGACAGGTTCATGATACAGGGGGGCGT
CATCTACACCGCCGTGGCATGCAAAGATTCCGAGACTCAAGGTACGAAGGCCCTTGGCTCGGTCTGTTGGGGCAT
AGCAAGTGAAATTGATATGTGGGCACAAGTGTACATTTTGCGTGCCGAGATGGACATTGTCAACGGCATCAGCCG
CAACTTGCCACCGACGGGCTGCTGCGTTGATCTCGGCAACCGCCAGCTCATCGACGCCAAGTTCCTCAACGACGA
AACCCTCGTGGTGCTTTGCAAAGAAAATGGTATGTCATCCGTCTGCCTCGACTCAAGGGCTCTTCGTCACTGACA
GGAAATGACTCAGACCTCTCGTCAGTCGCCCTGTCAATACCGATTCAGTCGAGTGAGCTGCCCTACGCTCCGCTG
GATGCCGGGGGGCTCAAGGATGTCGGCACCGCTCCAGTAGACAGCTTCGTCAGGCATCTGGTCCCCGAGCAGCAG
CCTACGAGGCCGGTGAGGATGGAGGTACACGATAAGAGTGAGGCCAAGGGGCAGATTCCCGAGAGGATTTGTCTC
CTCAGCAGCAACCAAACAACATGGCGAACGTACTGCATGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail