Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8215
Gene name
Locationscaffold_889:1900..3458
Strand+
Gene length (bp)1558
Transcript length (bp)1323
Coding sequence length (bp)1320
Protein length (aa) 440

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01266 DAO FAD dependent oxidoreductase 6.4E-69 6 408
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 2.4E-05 9 46

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q10058|YAM3_SCHPO Putative oxidoreductase C1F5.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F5.03c PE=3 SV=1 1 425 6.0E-57
sp|P38758|TDA3_YEAST Putative oxidoreductase TDA3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TDA3 PE=1 SV=2 145 427 6.0E-55
sp|P38758|TDA3_YEAST Putative oxidoreductase TDA3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TDA3 PE=1 SV=2 4 125 1.0E-17
sp|B7LSJ5|DADA_ESCF3 D-amino acid dehydrogenase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=dadA PE=3 SV=1 7 235 2.0E-06
sp|A9MP60|DADA_SALAR D-amino acid dehydrogenase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=dadA PE=3 SV=1 6 409 9.0E-06

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.5

Transmembrane Domains

Domain # Start End Length
1 7 24 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8215
MTEKRHIVIVGGGIVGCTTAYYLTRHPKFDGALHAVTLLEAASSVAAGASGRAGGLLGLWAYPACLVPLSFRLHA
QLAEEHDGARRWGYRRLACGSLSANISRRRLDQLRLAAPSSGSGHVGSRLWESLPKQDAAAAALMEPADLPPELD
WVDRSSVVGWEEMGDDETAETAQVHPLHLTTSMAELAQQAGVELRTLAKVTNLVSSADGAIEAVEYLDRRSGETK
TLDGITDVVVAAGPWTGRLLPRSKVEGLRAHSVVYEADVSPFAVFTDIRLPSDFVPEHRARRGQKRMHKGSVDPE
MYARPFGEVYACGEPDSAVPLPETADEVQCDEAQCDDILSYIATLSPLLAGAPVKAKQACYLPRHMRFGQESGPL
LGRTTVPGLWVAAGHTCWGIQNGPATGKLMSEMLLDGAATSADVEKLDPRKFKQQGLCEGIAGAE
Coding >Ophio5|8215
ATGACGGAGAAGCGCCATATCGTCATTGTCGGCGGCGGTATTGTCGGCTGTACGACGGCCTACTATCTGACTCGC
CACCCCAAGTTCGACGGAGCTCTACACGCCGTCACGCTACTCGAGGCCGCTTCGTCCGTCGCGGCCGGTGCTTCG
GGCCGTGCTGGCGGACTGTTGGGTCTATGGGCGTATCCTGCTTGTCTCGTCCCGCTTTCCTTTCGTCTGCATGCC
CAGCTGGCGGAAGAGCATGACGGCGCTCGTCGTTGGGGATATCGTCGTCTTGCCTGTGGGAGTCTCAGTGCCAAC
ATCTCTCGTCGTCGTTTGGATCAATTGCGCCTTGCGGCTCCGTCGTCTGGGTCCGGACATGTTGGGAGTCGGCTC
TGGGAGTCGCTTCCTAAGCAGGACGCTGCTGCGGCTGCCCTGATGGAGCCTGCTGATCTACCGCCTGAACTTGAT
TGGGTTGATCGCAGCTCCGTCGTCGGCTGGGAGGAGATGGGCGATGATGAGACGGCTGAAACGGCTCAGGTCCAT
CCACTGCATCTCACGACTTCCATGGCCGAGCTGGCGCAGCAGGCTGGCGTGGAGCTGCGTACGCTCGCCAAGGTT
ACCAACCTCGTCTCATCGGCCGACGGCGCCATCGAAGCTGTCGAGTATCTGGATCGAAGAAGCGGGGAGACCAAG
ACGCTGGACGGCATCACCGACGTCGTCGTCGCTGCTGGCCCTTGGACCGGCCGCCTACTGCCGCGATCCAAGGTC
GAGGGTCTGCGAGCGCACAGCGTCGTGTACGAGGCCGACGTCAGCCCCTTTGCCGTATTCACCGATATACGCCTG
CCGTCCGACTTTGTGCCGGAGCATCGCGCCCGTCGGGGCCAGAAGAGGATGCACAAGGGGTCCGTTGACCCGGAG
ATGTATGCCCGGCCCTTTGGCGAGGTCTATGCCTGTGGCGAACCGGACTCGGCCGTTCCCCTGCCCGAGACGGCC
GACGAGGTCCAATGCGACGAGGCCCAGTGCGACGACATTCTCTCCTACATCGCCACCCTCAGCCCCCTTCTCGCC
GGGGCGCCCGTCAAGGCCAAGCAGGCCTGTTACCTACCGCGTCACATGCGCTTCGGTCAAGAGAGCGGCCCGCTG
CTCGGCCGGACAACGGTGCCGGGCCTGTGGGTGGCCGCCGGCCACACGTGCTGGGGCATCCAGAACGGGCCCGCC
ACGGGCAAGCTCATGTCGGAGATGCTGCTGGACGGCGCCGCCACCAGCGCCGACGTGGAGAAGCTGGATCCGAGG
AAGTTTAAACAACAGGGACTTTGTGAAGGCATAGCCGGAGCAGAA
Transcript >Ophio5|8215
ATGACGGAGAAGCGCCATATCGTCATTGTCGGCGGCGGTATTGTCGGCTGTACGACGGCCTACTATCTGACTCGC
CACCCCAAGTTCGACGGAGCTCTACACGCCGTCACGCTACTCGAGGCCGCTTCGTCCGTCGCGGCCGGTGCTTCG
GGCCGTGCTGGCGGACTGTTGGGTCTATGGGCGTATCCTGCTTGTCTCGTCCCGCTTTCCTTTCGTCTGCATGCC
CAGCTGGCGGAAGAGCATGACGGCGCTCGTCGTTGGGGATATCGTCGTCTTGCCTGTGGGAGTCTCAGTGCCAAC
ATCTCTCGTCGTCGTTTGGATCAATTGCGCCTTGCGGCTCCGTCGTCTGGGTCCGGACATGTTGGGAGTCGGCTC
TGGGAGTCGCTTCCTAAGCAGGACGCTGCTGCGGCTGCCCTGATGGAGCCTGCTGATCTACCGCCTGAACTTGAT
TGGGTTGATCGCAGCTCCGTCGTCGGCTGGGAGGAGATGGGCGATGATGAGACGGCTGAAACGGCTCAGGTCCAT
CCACTGCATCTCACGACTTCCATGGCCGAGCTGGCGCAGCAGGCTGGCGTGGAGCTGCGTACGCTCGCCAAGGTT
ACCAACCTCGTCTCATCGGCCGACGGCGCCATCGAAGCTGTCGAGTATCTGGATCGAAGAAGCGGGGAGACCAAG
ACGCTGGACGGCATCACCGACGTCGTCGTCGCTGCTGGCCCTTGGACCGGCCGCCTACTGCCGCGATCCAAGGTC
GAGGGTCTGCGAGCGCACAGCGTCGTGTACGAGGCCGACGTCAGCCCCTTTGCCGTATTCACCGATATACGCCTG
CCGTCCGACTTTGTGCCGGAGCATCGCGCCCGTCGGGGCCAGAAGAGGATGCACAAGGGGTCCGTTGACCCGGAG
ATGTATGCCCGGCCCTTTGGCGAGGTCTATGCCTGTGGCGAACCGGACTCGGCCGTTCCCCTGCCCGAGACGGCC
GACGAGGTCCAATGCGACGAGGCCCAGTGCGACGACATTCTCTCCTACATCGCCACCCTCAGCCCCCTTCTCGCC
GGGGCGCCCGTCAAGGCCAAGCAGGCCTGTTACCTACCGCGTCACATGCGCTTCGGTCAAGAGAGCGGCCCGCTG
CTCGGCCGGACAACGGTGCCGGGCCTGTGGGTGGCCGCCGGCCACACGTGCTGGGGCATCCAGAACGGGCCCGCC
ACGGGCAAGCTCATGTCGGAGATGCTGCTGGACGGCGCCGCCACCAGCGCCGACGTGGAGAAGCTGGATCCGAGG
AAGTTTAAACAACAGGGACTTTGTGAAGGCATAGCCGGAGCAGAATGA
Gene >Ophio5|8215
ATGACGGAGAAGCGCCATATCGTCATTGTCGGTAGGCGTCATCGTCGTCATCGCCTCTCGCCCGCCAGCTGACGA
CGTCTGCGCAGGCGGCGGTATTGTCGGCTGTACGACGGCCTACTATCTGACTCGCCACCCCAAGTTCGACGGAGC
TCTACACGCCGTCACGCTACTCGAGGCCGCTTCGTCCGTCGCGGCCGGTGCTTCGGGCCGTGCTGGCGGACTGTT
GGGTCTATGGGCGTATCCTGCTTGTCTCGTCCCGCTTTCCTTTCGTCTGCATGCCCAGCTGGCGGAAGAGCATGA
CGGCGCTCGTCGTTGGGGATATCGTCGTCTTGCCTGTGGGAGTCTCAGTGCCAACATCTCTCGTCGTCGTTTGGA
TCAATTGCGCCTTGCGGCTCCGTCGTCTGGGTCCGGACATGTTGGGAGTCGGCTCTGGGAGTCGCTTCCTAAGCA
GGACGCTGCTGCGGCTGCCCTGATGGAGCCTGCTGATCTACCGCCTGAACTTGATTGGGTTGATCGCAGCTCCGT
CGTCGGCTGGGAGGAGATGGGCGATGATGAGACGGCTGAAACGGCTCAGGTCCATCCACTGCATCTCACGACTTC
CATGGCCGAGCTGGCGCAGCAGGCTGGCGTGGAGCTGCGTACGCTCGCCAAGGTTACCAACCTCGTCTCATCGGC
CGACGGCGCCATCGAAGCTGTCGAGTATCTGGATCGAAGAAGCGGGGAGACCAAGACGCTGGACGGCATCACCGA
CGTCGTCGTCGCTGCTGGCCCTTGGACCGGCCGCCTACTGCCGCGATCCAAGGTCGAGGGTCTGCGAGCGCACAG
CGTCGTGTACGAGGCCGACGTCAGCCCCTTTGCCGTATTCACCGATATACGCCTGCCGTCCGACTTTGTGCCGGA
GCATCGCGCCCGTCGGGGCCAGAAGAGGATGCACAAGGGGTCCGTTGACCCGGAGATGTATGCCCGGCCCTTTGG
CGAGGTCTATGCCTGTGGTGAGACTCTTGATTCTCCCCCATTTCATTCTTGACTCATGTTGCGTCCCTCACCCCC
AAGGCGAACCGGACTCGGCCGTTCCCCTGCCCGAGACGGCCGACGAGGTCCAATGCGACGAGGCCCAGTGCGACG
ACATTCTCTCCTACATCGCCACCCTCAGCCCCCTTCTCGCCGGGGCGCCCGTCAAGGCCAAGCAGGCCTGTTACC
TACCGCGTCACATGCGCTTCGGTCAAGAGAGCGGCCCGCTGCTCGGCCGGACAACGGTGCCGGGCCTGTGGGTGG
CCGCCGGCCACACGTGCTGGGGCATCCAGAACGGGCCCGCCACGGGCAAGCTCATGTCGGAGATGCTGCTGGACG
GCGCCGCCACCAGCGCCGACGTGGAGAAGCTGGATCCGAGGAAGTTTAAAGTCTAGAGATGATCTGCACACAACT
TGGGACGGTCCAGCAACAGGGACTTTGTGAAGGCATAGCCGGTGAGACTCGCCGGTTCGTGAGAGACGGCGAGGT
GGTGAGAAGCTCTGCCGGGCGGCGAATGTCTACTGATGGTGGCCCAGGAGCAGAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail