© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | Ophio5|8211 |
| Gene name | |
| Location | scaffold_887:3735..5550 |
| Strand | - |
| Gene length (bp) | 1815 |
| Transcript length (bp) | 1509 |
| Coding sequence length (bp) | 1506 |
| Protein length (aa) | 502 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF07724 | AAA_2 | AAA domain (Cdc48 subfamily) | 1.5E-28 | 189 | 359 |
| PF00004 | AAA | ATPase family associated with various cellular activities (AAA) | 1.1E-11 | 192 | 296 |
| PF10431 | ClpB_D2-small | C-terminal, D2-small domain, of ClpB protein | 4.3E-07 | 386 | 443 |
| PF07728 | AAA_5 | AAA domain (dynein-related subfamily) | 1.1E-05 | 191 | 267 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P38323|CLPX_YEAST | ATP-dependent clpX-like chaperone, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCX1 PE=1 SV=1 | 75 | 363 | 2.0E-57 |
| sp|C3PI25|CLPX_CORA7 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=clpX PE=3 SV=1 | 75 | 454 | 3.0E-56 |
| sp|A1AN84|CLPX_PELPD | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Pelobacter propionicus (strain DSM 2379) GN=clpX PE=3 SV=1 | 138 | 459 | 7.0E-56 |
| sp|B3QPN4|CLPX_CHLP8 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Chlorobaculum parvum (strain NCIB 8327) GN=clpX PE=3 SV=1 | 71 | 471 | 1.0E-55 |
| sp|B2HNG2|CLPX_MYCMM | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=clpX PE=3 SV=1 | 180 | 444 | 2.0E-55 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P38323|CLPX_YEAST | ATP-dependent clpX-like chaperone, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCX1 PE=1 SV=1 | 75 | 363 | 2.0E-57 |
| sp|C3PI25|CLPX_CORA7 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=clpX PE=3 SV=1 | 75 | 454 | 3.0E-56 |
| sp|A1AN84|CLPX_PELPD | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Pelobacter propionicus (strain DSM 2379) GN=clpX PE=3 SV=1 | 138 | 459 | 7.0E-56 |
| sp|B3QPN4|CLPX_CHLP8 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Chlorobaculum parvum (strain NCIB 8327) GN=clpX PE=3 SV=1 | 71 | 471 | 1.0E-55 |
| sp|B2HNG2|CLPX_MYCMM | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=clpX PE=3 SV=1 | 180 | 444 | 2.0E-55 |
| sp|A0PU31|CLPX_MYCUA | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Mycobacterium ulcerans (strain Agy99) GN=clpX PE=3 SV=1 | 180 | 444 | 2.0E-55 |
| sp|Q73XN1|CLPX_MYCPA | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=clpX PE=3 SV=1 | 180 | 444 | 3.0E-55 |
| sp|A0QDF5|CLPX_MYCA1 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Mycobacterium avium (strain 104) GN=clpX PE=3 SV=1 | 180 | 444 | 3.0E-55 |
| sp|C1AES4|CLPX_MYCBT | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=clpX PE=3 SV=1 | 180 | 444 | 3.0E-55 |
| sp|A1KLF3|CLPX_MYCBP | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=clpX PE=3 SV=1 | 180 | 444 | 3.0E-55 |
| sp|O67356|CLPX_AQUAE | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Aquifex aeolicus (strain VF5) GN=clpX PE=3 SV=1 | 183 | 459 | 4.0E-55 |
| sp|P9WPB9|CLPX_MYCTU | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=clpX PE=1 SV=1 | 180 | 444 | 4.0E-55 |
| sp|A5U5F3|CLPX_MYCTA | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=clpX PE=3 SV=1 | 180 | 444 | 4.0E-55 |
| sp|P0A529|CLPX_MYCBO | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=clpX PE=3 SV=1 | 180 | 444 | 4.0E-55 |
| sp|B1XUS8|CLPX_POLNS | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=clpX PE=3 SV=1 | 75 | 454 | 6.0E-55 |
| sp|Q6A7F1|CLPX_PROAC | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=clpX PE=3 SV=1 | 75 | 463 | 7.0E-55 |
| sp|Q9CBY6|CLPX_MYCLE | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Mycobacterium leprae (strain TN) GN=clpX PE=3 SV=1 | 180 | 444 | 9.0E-55 |
| sp|B8ZRP1|CLPX_MYCLB | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Mycobacterium leprae (strain Br4923) GN=clpX PE=3 SV=1 | 180 | 444 | 9.0E-55 |
| sp|A4T2N8|CLPX_MYCGI | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Mycobacterium gilvum (strain PYR-GCK) GN=clpX PE=3 SV=1 | 180 | 444 | 2.0E-54 |
| sp|P9WPB8|CLPX_MYCTO | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=clpX PE=3 SV=1 | 180 | 444 | 3.0E-54 |
| sp|A6WDT9|CLPX_KINRD | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=clpX PE=3 SV=1 | 147 | 444 | 3.0E-54 |
| sp|A0R196|CLPX_MYCS2 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=clpX PE=3 SV=1 | 180 | 444 | 3.0E-54 |
| sp|A0LSV2|CLPX_ACIC1 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=clpX PE=3 SV=1 | 180 | 444 | 1.0E-53 |
| sp|A4SXD7|CLPX_POLSQ | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=clpX PE=3 SV=1 | 75 | 454 | 1.0E-53 |
| sp|Q1B601|CLPX_MYCSS | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Mycobacterium sp. (strain MCS) GN=clpX PE=3 SV=1 | 180 | 444 | 1.0E-53 |
| sp|A1UJ35|CLPX_MYCSK | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Mycobacterium sp. (strain KMS) GN=clpX PE=3 SV=1 | 180 | 444 | 1.0E-53 |
| sp|A3Q2I1|CLPX_MYCSJ | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Mycobacterium sp. (strain JLS) GN=clpX PE=3 SV=1 | 180 | 444 | 1.0E-53 |
| sp|B3E1Z3|CLPX_GEOLS | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=clpX PE=3 SV=1 | 138 | 444 | 2.0E-53 |
| sp|B1MMV6|CLPX_MYCA9 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=clpX PE=3 SV=1 | 180 | 444 | 3.0E-53 |
| sp|Q39UH3|CLPX_GEOMG | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=clpX PE=3 SV=1 | 117 | 459 | 3.0E-53 |
| sp|B8I8F6|CLPX_CLOCE | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=clpX PE=3 SV=1 | 138 | 458 | 4.0E-53 |
| sp|Q0AQ06|CLPX_MARMM | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Maricaulis maris (strain MCS10) GN=clpX PE=3 SV=1 | 171 | 444 | 5.0E-53 |
| sp|A1TCB3|CLPX_MYCVP | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=clpX PE=3 SV=1 | 180 | 444 | 5.0E-53 |
| sp|A6X117|CLPX_OCHA4 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=clpX PE=3 SV=1 | 180 | 463 | 5.0E-53 |
| sp|A6U7U8|CLPX_SINMW | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Sinorhizobium medicae (strain WSM419) GN=clpX PE=3 SV=1 | 180 | 463 | 7.0E-53 |
| sp|C1A1N6|CLPX_RHOE4 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=clpX PE=3 SV=1 | 180 | 444 | 8.0E-53 |
| sp|Q2JDQ7|CLPX_FRASC | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Frankia sp. (strain CcI3) GN=clpX PE=3 SV=1 | 138 | 444 | 9.0E-53 |
| sp|Q7VP79|CLPX_HAEDU | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=clpX PE=3 SV=1 | 185 | 459 | 9.0E-53 |
| sp|A1SME0|CLPX_NOCSJ | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Nocardioides sp. (strain BAA-499 / JS614) GN=clpX PE=3 SV=1 | 180 | 444 | 1.0E-52 |
| sp|B2UX12|CLPX_CLOBA | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=clpX PE=3 SV=1 | 185 | 458 | 1.0E-52 |
| sp|Q8KFC3|CLPX_CHLTE | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=clpX PE=3 SV=1 | 71 | 468 | 1.0E-52 |
| sp|Q1MIM6|CLPX_RHIL3 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=clpX PE=3 SV=1 | 171 | 466 | 1.0E-52 |
| sp|C3MA45|CLPX_RHISN | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rhizobium sp. (strain NGR234) GN=clpX PE=3 SV=1 | 180 | 466 | 2.0E-52 |
| sp|B5ZY09|CLPX_RHILW | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=clpX PE=3 SV=1 | 180 | 466 | 2.0E-52 |
| sp|A4XHW1|CLPX_CALS8 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=clpX PE=3 SV=1 | 180 | 459 | 2.0E-52 |
| sp|C1AVQ3|CLPX_RHOOB | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rhodococcus opacus (strain B4) GN=clpX PE=3 SV=1 | 180 | 444 | 2.0E-52 |
| sp|Q0SGZ3|CLPX_RHOJR | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rhodococcus jostii (strain RHA1) GN=clpX PE=3 SV=1 | 180 | 444 | 2.0E-52 |
| sp|Q2W3I0|CLPX_MAGSA | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=clpX PE=3 SV=1 | 171 | 463 | 2.0E-52 |
| sp|Q2K9U6|CLPX_RHIEC | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=clpX PE=3 SV=1 | 180 | 466 | 2.0E-52 |
| sp|B3PVY5|CLPX_RHIE6 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rhizobium etli (strain CIAT 652) GN=clpX PE=3 SV=1 | 180 | 466 | 2.0E-52 |
| sp|Q92QQ2|CLPX_RHIME | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rhizobium meliloti (strain 1021) GN=clpX PE=3 SV=1 | 180 | 463 | 2.0E-52 |
| sp|Q0RPH1|CLPX_FRAAA | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Frankia alni (strain ACN14a) GN=clpX PE=3 SV=1 | 184 | 444 | 3.0E-52 |
| sp|B9MQ33|CLPX_CALBD | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=clpX PE=3 SV=1 | 179 | 459 | 3.0E-52 |
| sp|Q5Z061|CLPX_NOCFA | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Nocardia farcinica (strain IFM 10152) GN=clpX PE=3 SV=1 | 180 | 444 | 3.0E-52 |
| sp|B2S5W0|CLPX_BRUA1 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Brucella abortus (strain S19) GN=clpX PE=3 SV=1 | 180 | 463 | 3.0E-52 |
| sp|Q8XKK2|CLPX_CLOPE | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Clostridium perfringens (strain 13 / Type A) GN=clpX PE=3 SV=1 | 142 | 455 | 4.0E-52 |
| sp|Q0TQK3|CLPX_CLOP1 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=clpX PE=3 SV=1 | 142 | 455 | 4.0E-52 |
| sp|Q66GN9|CLPX3_ARATH | CLP protease regulatory subunit CLPX3, mitochondrial OS=Arabidopsis thaliana GN=CLPX3 PE=2 SV=1 | 75 | 443 | 4.0E-52 |
| sp|Q0ST54|CLPX_CLOPS | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Clostridium perfringens (strain SM101 / Type A) GN=clpX PE=3 SV=1 | 142 | 455 | 4.0E-52 |
| sp|B2TPB8|CLPX_CLOBB | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=clpX PE=3 SV=1 | 185 | 458 | 4.0E-52 |
| sp|Q8RC24|CLPX_CALS4 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=clpX PE=3 SV=1 | 181 | 454 | 4.0E-52 |
| sp|Q180E8|CLPX_PEPD6 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Peptoclostridium difficile (strain 630) GN=clpX PE=3 SV=1 | 173 | 454 | 4.0E-52 |
| sp|A5CR08|CLPX_CLAM3 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=clpX PE=3 SV=1 | 75 | 457 | 5.0E-52 |
| sp|B9JVD6|CLPX_AGRVS | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=clpX PE=3 SV=1 | 171 | 466 | 5.0E-52 |
| sp|B2GGB7|CLPX_KOCRD | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=clpX PE=3 SV=1 | 183 | 454 | 5.0E-52 |
| sp|A8L1X0|CLPX_FRASN | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Frankia sp. (strain EAN1pec) GN=clpX PE=3 SV=1 | 184 | 444 | 5.0E-52 |
| sp|B0RAS4|CLPX_CLAMS | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=clpX PE=3 SV=1 | 75 | 457 | 6.0E-52 |
| sp|Q2NDC1|CLPX_ERYLH | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Erythrobacter litoralis (strain HTCC2594) GN=clpX PE=3 SV=1 | 171 | 443 | 7.0E-52 |
| sp|B1L1D6|CLPX_CLOBM | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=clpX PE=3 SV=1 | 147 | 455 | 7.0E-52 |
| sp|Q74C83|CLPX_GEOSL | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=clpX PE=3 SV=1 | 117 | 459 | 8.0E-52 |
| sp|A5GFA1|CLPX_GEOUR | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Geobacter uraniireducens (strain Rf4) GN=clpX PE=3 SV=1 | 90 | 459 | 8.0E-52 |
| sp|Q73M37|CLPX_TREDE | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=clpX PE=3 SV=1 | 185 | 444 | 8.0E-52 |
| sp|Q8YHC7|CLPX_BRUME | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=clpX PE=3 SV=1 | 180 | 463 | 1.0E-51 |
| sp|C0RJ80|CLPX_BRUMB | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=clpX PE=3 SV=1 | 180 | 463 | 1.0E-51 |
| sp|Q9L7X5|CLPX_BRUAB | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Brucella abortus biovar 1 (strain 9-941) GN=clpX PE=3 SV=2 | 180 | 463 | 1.0E-51 |
| sp|Q2YPX2|CLPX_BRUA2 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Brucella abortus (strain 2308) GN=clpX PE=3 SV=1 | 180 | 463 | 1.0E-51 |
| sp|B8CY73|CLPX_HALOH | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=clpX PE=3 SV=1 | 138 | 444 | 1.0E-51 |
| sp|B8HA33|CLPX_ARTCA | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=clpX PE=3 SV=1 | 178 | 458 | 1.0E-51 |
| sp|Q8G0I5|CLPX_BRUSU | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Brucella suis biovar 1 (strain 1330) GN=clpX PE=3 SV=1 | 180 | 463 | 1.0E-51 |
| sp|B0CGR0|CLPX_BRUSI | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=clpX PE=3 SV=1 | 180 | 463 | 1.0E-51 |
| sp|A7GIH1|CLPX_CLOBL | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=clpX PE=3 SV=1 | 147 | 455 | 1.0E-51 |
| sp|B1IND6|CLPX_CLOBK | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Clostridium botulinum (strain Okra / Type B1) GN=clpX PE=3 SV=1 | 147 | 455 | 1.0E-51 |
| sp|C1FLA5|CLPX_CLOBJ | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Clostridium botulinum (strain Kyoto / Type A2) GN=clpX PE=3 SV=1 | 147 | 455 | 1.0E-51 |
| sp|A5I6W0|CLPX_CLOBH | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=clpX PE=3 SV=1 | 147 | 455 | 1.0E-51 |
| sp|C3KU76|CLPX_CLOB6 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Clostridium botulinum (strain 657 / Type Ba4) GN=clpX PE=3 SV=1 | 147 | 455 | 1.0E-51 |
| sp|A7FYI1|CLPX_CLOB1 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=clpX PE=3 SV=1 | 147 | 455 | 1.0E-51 |
| sp|B2S3A2|CLPX_TREPS | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Treponema pallidum subsp. pallidum (strain SS14) GN=clpX PE=3 SV=1 | 183 | 462 | 1.0E-51 |
| sp|O83521|CLPX_TREPA | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Treponema pallidum (strain Nichols) GN=clpX PE=3 SV=1 | 183 | 462 | 1.0E-51 |
| sp|B9DNC0|CLPX_STACT | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Staphylococcus carnosus (strain TM300) GN=clpX PE=3 SV=1 | 181 | 468 | 1.0E-51 |
| sp|A5VQN3|CLPX_BRUO2 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=clpX PE=3 SV=1 | 180 | 463 | 1.0E-51 |
| sp|Q5LUP9|CLPX_RUEPO | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=clpX PE=3 SV=2 | 185 | 444 | 2.0E-51 |
| sp|Q8UFY5|CLPX_AGRFC | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=clpX PE=3 SV=1 | 180 | 466 | 2.0E-51 |
| sp|B0KBA3|CLPX_THEP3 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=clpX PE=3 SV=1 | 181 | 444 | 2.0E-51 |
| sp|B0K532|CLPX_THEPX | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Thermoanaerobacter sp. (strain X514) GN=clpX PE=3 SV=1 | 181 | 444 | 2.0E-51 |
| sp|A1BE59|CLPX_CHLPD | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Chlorobium phaeobacteroides (strain DSM 266) GN=clpX PE=3 SV=1 | 65 | 468 | 2.0E-51 |
| sp|B0TFI7|CLPX_HELMI | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=clpX PE=3 SV=1 | 138 | 444 | 2.0E-51 |
| sp|Q8FN57|CLPX_COREF | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=clpX PE=3 SV=1 | 183 | 456 | 2.0E-51 |
| sp|A6LT28|CLPX_CLOB8 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=clpX PE=3 SV=1 | 185 | 455 | 2.0E-51 |
| sp|A7MV82|CLPX_VIBCB | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=clpX PE=3 SV=1 | 183 | 456 | 2.0E-51 |
| sp|Q87R79|CLPX_VIBPA | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=clpX PE=3 SV=1 | 183 | 456 | 3.0E-51 |
| sp|B9M0Y2|CLPX_GEODF | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=clpX PE=3 SV=1 | 90 | 459 | 3.0E-51 |
| sp|A9WUW1|CLPX_RENSM | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=clpX PE=3 SV=1 | 178 | 444 | 4.0E-51 |
| sp|B2A159|CLPX_NATTJ | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=clpX PE=3 SV=1 | 178 | 459 | 4.0E-51 |
| sp|Q2G3T4|CLPX_NOVAD | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=clpX PE=3 SV=1 | 171 | 444 | 5.0E-51 |
| sp|Q8GJP6|CLPX_LACLM | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=clpX PE=3 SV=1 | 183 | 456 | 5.0E-51 |
| sp|Q7VGY5|CLPX_HELHP | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=clpX PE=3 SV=1 | 37 | 454 | 6.0E-51 |
| sp|B6ISY6|CLPX_RHOCS | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=clpX PE=3 SV=1 | 140 | 471 | 6.0E-51 |
| sp|B4SEI4|CLPX_PELPB | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=clpX PE=3 SV=1 | 72 | 474 | 7.0E-51 |
| sp|Q982V5|CLPX_RHILO | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rhizobium loti (strain MAFF303099) GN=clpX PE=3 SV=1 | 181 | 463 | 7.0E-51 |
| sp|A0Q2L0|CLPX_CLONN | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Clostridium novyi (strain NT) GN=clpX PE=3 SV=1 | 183 | 467 | 7.0E-51 |
| sp|Q6FEP7|CLPX_ACIAD | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=clpX PE=3 SV=1 | 185 | 462 | 7.0E-51 |
| sp|Q9K8F4|CLPX_BACHD | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=clpX PE=3 SV=1 | 138 | 467 | 8.0E-51 |
| sp|B7VHZ9|CLPX_VIBTL | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Vibrio tasmaniensis (strain LGP32) GN=clpX PE=3 SV=1 | 183 | 456 | 8.0E-51 |
| sp|A3DJ11|CLPX_CLOTH | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=clpX PE=3 SV=1 | 138 | 444 | 9.0E-51 |
| sp|Q30Z80|CLPX_DESAG | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Desulfovibrio alaskensis (strain G20) GN=clpX PE=3 SV=1 | 183 | 444 | 9.0E-51 |
| sp|A1VE84|CLPX_DESVV | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=clpX PE=3 SV=1 | 184 | 444 | 1.0E-50 |
| sp|Q72CE7|CLPX_DESVH | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=clpX PE=3 SV=1 | 184 | 444 | 1.0E-50 |
| sp|Q1QVW2|CLPX_CHRSD | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=clpX PE=3 SV=1 | 120 | 467 | 1.0E-50 |
| sp|Q6AFZ6|CLPX_LEIXX | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=clpX PE=3 SV=1 | 185 | 444 | 1.0E-50 |
| sp|Q28NI8|CLPX_JANSC | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Jannaschia sp. (strain CCS1) GN=clpX PE=3 SV=1 | 180 | 443 | 1.0E-50 |
| sp|Q9X5N1|CLPX_MYXXA | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Myxococcus xanthus GN=clpX PE=3 SV=1 | 141 | 454 | 1.0E-50 |
| sp|C3LNM5|CLPX_VIBCM | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Vibrio cholerae serotype O1 (strain M66-2) GN=clpX PE=3 SV=1 | 183 | 456 | 1.0E-50 |
| sp|Q9KQS7|CLPX_VIBCH | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=clpX PE=3 SV=1 | 183 | 456 | 1.0E-50 |
| sp|A5F6Z1|CLPX_VIBC3 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=clpX PE=3 SV=1 | 183 | 456 | 1.0E-50 |
| sp|A4SM43|CLPX_AERS4 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Aeromonas salmonicida (strain A449) GN=clpX PE=3 SV=1 | 171 | 456 | 1.0E-50 |
| sp|C6E2S9|CLPX_GEOSM | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Geobacter sp. (strain M21) GN=clpX PE=3 SV=1 | 117 | 459 | 2.0E-50 |
| sp|B5EI28|CLPX_GEOBB | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=clpX PE=3 SV=1 | 117 | 459 | 2.0E-50 |
| sp|P0CAU2|CLPX_CAUCR | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=clpX PE=1 SV=1 | 171 | 444 | 2.0E-50 |
| sp|B8GX14|CLPX_CAUCN | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=clpX PE=3 SV=1 | 171 | 444 | 2.0E-50 |
| sp|Q2GFT9|CLPX_EHRCR | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=clpX PE=3 SV=1 | 135 | 443 | 2.0E-50 |
| sp|A2SFB6|CLPX_METPP | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Methylibium petroleiphilum (strain PM1) GN=clpX PE=3 SV=1 | 177 | 444 | 2.0E-50 |
| sp|Q9FK07|CLPX1_ARATH | CLP protease regulatory subunit CLPX1, mitochondrial OS=Arabidopsis thaliana GN=CLPX1 PE=2 SV=1 | 54 | 492 | 2.0E-50 |
| sp|Q49YA6|CLPX_STAS1 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=clpX PE=3 SV=1 | 183 | 469 | 3.0E-50 |
| sp|Q165G0|CLPX_ROSDO | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=clpX PE=3 SV=1 | 181 | 443 | 3.0E-50 |
| sp|B3ENA3|CLPX_CHLPB | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Chlorobium phaeobacteroides (strain BS1) GN=clpX PE=3 SV=1 | 183 | 468 | 3.0E-50 |
| sp|C4L4J1|CLPX_EXISA | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=clpX PE=3 SV=1 | 181 | 470 | 3.0E-50 |
| sp|Q0A6A8|CLPX_ALKEH | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=clpX PE=3 SV=1 | 145 | 456 | 3.0E-50 |
| sp|P70730|CLPX_AZOBR | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Azospirillum brasilense GN=clpX PE=3 SV=2 | 180 | 470 | 3.0E-50 |
| sp|Q83MI6|CLPX_TROW8 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Tropheryma whipplei (strain TW08/27) GN=clpX PE=3 SV=1 | 81 | 444 | 4.0E-50 |
| sp|Q9CGE6|CLPX_LACLA | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=clpX PE=3 SV=1 | 183 | 456 | 4.0E-50 |
| sp|A1U1Q2|CLPX_MARHV | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=clpX PE=3 SV=1 | 185 | 456 | 4.0E-50 |
| sp|A9M5C1|CLPX_BRUC2 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=clpX PE=3 SV=1 | 180 | 463 | 4.0E-50 |
| sp|Q1GGF7|CLPX_RUEST | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Ruegeria sp. (strain TM1040) GN=clpX PE=3 SV=1 | 185 | 443 | 4.0E-50 |
| sp|Q8NN26|CLPX_CORGL | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=clpX PE=3 SV=1 | 189 | 443 | 4.0E-50 |
| sp|A0JXL2|CLPX_ARTS2 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Arthrobacter sp. (strain FB24) GN=clpX PE=3 SV=1 | 183 | 444 | 4.0E-50 |
| sp|Q1GPH4|CLPX_SPHAL | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=clpX PE=3 SV=1 | 171 | 443 | 4.0E-50 |
| sp|A8AXB9|CLPX_STRGC | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=clpX PE=3 SV=1 | 178 | 459 | 5.0E-50 |
| sp|Q7MMG6|CLPX_VIBVY | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Vibrio vulnificus (strain YJ016) GN=clpX PE=3 SV=1 | 185 | 456 | 5.0E-50 |
| sp|Q8DG27|CLPX_VIBVU | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Vibrio vulnificus (strain CMCP6) GN=clpX PE=3 SV=1 | 185 | 456 | 5.0E-50 |
| sp|A9ISA8|CLPX_BART1 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=clpX PE=3 SV=1 | 180 | 443 | 5.0E-50 |
| sp|Q83G50|CLPX_TROWT | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Tropheryma whipplei (strain Twist) GN=clpX PE=3 SV=1 | 81 | 444 | 5.0E-50 |
| sp|Q02Z22|CLPX_LACLS | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=clpX PE=3 SV=1 | 183 | 456 | 6.0E-50 |
| sp|Q5E6Q4|CLPX_VIBF1 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=clpX PE=3 SV=1 | 178 | 456 | 6.0E-50 |
| sp|Q1QL77|CLPX_NITHX | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=clpX PE=3 SV=1 | 180 | 466 | 6.0E-50 |
| sp|B5Y0U1|CLPX_KLEP3 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Klebsiella pneumoniae (strain 342) GN=clpX PE=3 SV=1 | 185 | 459 | 6.0E-50 |
| sp|Q89KG2|CLPX_BRADU | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=clpX PE=3 SV=1 | 180 | 466 | 6.0E-50 |
| sp|A8MIS7|CLPX_ALKOO | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Alkaliphilus oremlandii (strain OhILAs) GN=clpX PE=3 SV=1 | 185 | 480 | 6.0E-50 |
| sp|Q215J1|CLPX_RHOPB | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rhodopseudomonas palustris (strain BisB18) GN=clpX PE=3 SV=1 | 180 | 466 | 7.0E-50 |
| sp|Q07NN5|CLPX_RHOP5 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rhodopseudomonas palustris (strain BisA53) GN=clpX PE=3 SV=1 | 180 | 466 | 7.0E-50 |
| sp|B3Q7P4|CLPX_RHOPT | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rhodopseudomonas palustris (strain TIE-1) GN=clpX PE=3 SV=1 | 180 | 466 | 7.0E-50 |
| sp|Q6N5L4|CLPX_RHOPA | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=clpX PE=3 SV=1 | 180 | 466 | 7.0E-50 |
| sp|B5FBZ9|CLPX_VIBFM | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Vibrio fischeri (strain MJ11) GN=clpX PE=3 SV=1 | 178 | 456 | 7.0E-50 |
| sp|A1WUM6|CLPX_HALHL | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=clpX PE=3 SV=1 | 171 | 456 | 7.0E-50 |
| sp|A5EKA7|CLPX_BRASB | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=clpX PE=3 SV=1 | 180 | 466 | 7.0E-50 |
| sp|Q2YTB5|CLPX_STAAB | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=clpX PE=3 SV=1 | 181 | 444 | 9.0E-50 |
| sp|A1USA8|CLPX_BARBK | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=clpX PE=3 SV=1 | 180 | 463 | 9.0E-50 |
| sp|Q135W8|CLPX_RHOPS | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rhodopseudomonas palustris (strain BisB5) GN=clpX PE=3 SV=1 | 180 | 466 | 9.0E-50 |
| sp|A6TM62|CLPX_ALKMQ | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Alkaliphilus metalliredigens (strain QYMF) GN=clpX PE=3 SV=1 | 180 | 466 | 9.0E-50 |
| sp|A0KJU2|CLPX_AERHH | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=clpX PE=3 SV=1 | 185 | 456 | 1.0E-49 |
| sp|Q2IWZ3|CLPX_RHOP2 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rhodopseudomonas palustris (strain HaA2) GN=clpX PE=3 SV=1 | 180 | 466 | 1.0E-49 |
| sp|A6T5I1|CLPX_KLEP7 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=clpX PE=3 SV=1 | 185 | 459 | 1.0E-49 |
| sp|C5BXF8|CLPX_BEUC1 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=clpX PE=3 SV=1 | 185 | 443 | 1.0E-49 |
| sp|A8Z2J5|CLPX_STAAT | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=clpX PE=3 SV=1 | 181 | 444 | 1.0E-49 |
| sp|P63790|CLPX_STAAN | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Staphylococcus aureus (strain N315) GN=clpX PE=1 SV=1 | 181 | 444 | 1.0E-49 |
| sp|P63789|CLPX_STAAM | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=clpX PE=3 SV=1 | 181 | 444 | 1.0E-49 |
| sp|A6QHK8|CLPX_STAAE | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Staphylococcus aureus (strain Newman) GN=clpX PE=3 SV=1 | 181 | 444 | 1.0E-49 |
| sp|Q5HF98|CLPX_STAAC | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Staphylococcus aureus (strain COL) GN=clpX PE=3 SV=1 | 181 | 444 | 1.0E-49 |
| sp|A5ITJ9|CLPX_STAA9 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Staphylococcus aureus (strain JH9) GN=clpX PE=3 SV=1 | 181 | 444 | 1.0E-49 |
| sp|Q2FXQ7|CLPX_STAA8 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Staphylococcus aureus (strain NCTC 8325) GN=clpX PE=3 SV=1 | 181 | 444 | 1.0E-49 |
| sp|Q2FG62|CLPX_STAA3 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Staphylococcus aureus (strain USA300) GN=clpX PE=3 SV=1 | 181 | 444 | 1.0E-49 |
| sp|A6U2E2|CLPX_STAA2 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Staphylococcus aureus (strain JH1) GN=clpX PE=3 SV=1 | 181 | 444 | 1.0E-49 |
| sp|A7X396|CLPX_STAA1 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=clpX PE=3 SV=1 | 181 | 444 | 1.0E-49 |
| sp|A7HY53|CLPX_PARL1 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=clpX PE=3 SV=1 | 171 | 463 | 1.0E-49 |
| sp|A4QGA7|CLPX_CORGB | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Corynebacterium glutamicum (strain R) GN=clpX PE=3 SV=1 | 189 | 443 | 1.0E-49 |
| sp|Q6GG31|CLPX_STAAR | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Staphylococcus aureus (strain MRSA252) GN=clpX PE=3 SV=1 | 181 | 444 | 1.0E-49 |
| sp|A7MFI7|CLPX_CROS8 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=clpX PE=3 SV=1 | 178 | 465 | 1.0E-49 |
| sp|Q8NW72|CLPX_STAAW | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Staphylococcus aureus (strain MW2) GN=clpX PE=3 SV=1 | 181 | 444 | 1.0E-49 |
| sp|Q6G8Q1|CLPX_STAAS | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Staphylococcus aureus (strain MSSA476) GN=clpX PE=3 SV=1 | 181 | 444 | 1.0E-49 |
| sp|Q6G177|CLPX_BARQU | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bartonella quintana (strain Toulouse) GN=clpX PE=3 SV=1 | 180 | 463 | 1.0E-49 |
| sp|Q3SRD3|CLPX_NITWN | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=clpX PE=3 SV=1 | 180 | 466 | 1.0E-49 |
| sp|Q5WVJ1|CLPX_LEGPL | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Legionella pneumophila (strain Lens) GN=clpX PE=3 SV=1 | 185 | 459 | 1.0E-49 |
| sp|A5ID16|CLPX_LEGPC | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Legionella pneumophila (strain Corby) GN=clpX PE=3 SV=1 | 185 | 459 | 1.0E-49 |
| sp|Q5NNY7|CLPX_ZYMMO | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=clpX PE=3 SV=1 | 181 | 444 | 2.0E-49 |
| sp|Q3YSQ2|CLPX_EHRCJ | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Ehrlichia canis (strain Jake) GN=clpX PE=3 SV=1 | 138 | 443 | 2.0E-49 |
| sp|A3CMV1|CLPX_STRSV | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus sanguinis (strain SK36) GN=clpX PE=3 SV=1 | 178 | 459 | 2.0E-49 |
| sp|C0QHJ8|CLPX_DESAH | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=clpX PE=3 SV=1 | 75 | 458 | 2.0E-49 |
| sp|Q11J59|CLPX_CHESB | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Chelativorans sp. (strain BNC1) GN=clpX PE=3 SV=1 | 181 | 463 | 2.0E-49 |
| sp|Q6AK60|CLPX_DESPS | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=clpX PE=3 SV=1 | 70 | 444 | 2.0E-49 |
| sp|Q891J8|CLPX_CLOTE | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Clostridium tetani (strain Massachusetts / E88) GN=clpX PE=3 SV=1 | 183 | 454 | 2.0E-49 |
| sp|B2IR87|CLPX_STRPS | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus pneumoniae (strain CGSP14) GN=clpX PE=3 SV=1 | 181 | 459 | 2.0E-49 |
| sp|B8ZLT1|CLPX_STRPJ | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=clpX PE=3 SV=1 | 181 | 459 | 2.0E-49 |
| sp|Q5X452|CLPX_LEGPA | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Legionella pneumophila (strain Paris) GN=clpX PE=3 SV=1 | 185 | 459 | 2.0E-49 |
| sp|Q6NFU7|CLPX_CORDI | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=clpX PE=3 SV=1 | 183 | 459 | 2.0E-49 |
| sp|A8ZXB8|CLPX_DESOH | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=clpX PE=3 SV=1 | 140 | 458 | 2.0E-49 |
| sp|A8AK15|CLPX_CITK8 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=clpX PE=3 SV=1 | 178 | 459 | 2.0E-49 |
| sp|A4YVM3|CLPX_BRASO | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bradyrhizobium sp. (strain ORS278) GN=clpX PE=3 SV=1 | 180 | 466 | 3.0E-49 |
| sp|B7LME1|CLPX_ESCF3 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=clpX PE=3 SV=1 | 185 | 459 | 3.0E-49 |
| sp|Q8CXB8|CLPX_OCEIH | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=clpX PE=3 SV=1 | 183 | 444 | 3.0E-49 |
| sp|Q6G3Z2|CLPX_BARHE | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=clpX PE=3 SV=1 | 180 | 443 | 3.0E-49 |
| sp|A8F2I3|CLPX_RICM5 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rickettsia massiliae (strain Mtu5) GN=clpX PE=3 SV=1 | 185 | 456 | 3.0E-49 |
| sp|B5QTJ7|CLPX_SALEP | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Salmonella enteritidis PT4 (strain P125109) GN=clpX PE=3 SV=1 | 178 | 459 | 3.0E-49 |
| sp|B5YI39|CLPX_THEYD | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=clpX PE=3 SV=1 | 186 | 444 | 3.0E-49 |
| sp|A9MM22|CLPX_SALAR | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=clpX PE=3 SV=1 | 178 | 459 | 3.0E-49 |
| sp|Q8ZRC0|CLPX_SALTY | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=clpX PE=3 SV=1 | 178 | 459 | 3.0E-49 |
| sp|B4TMC7|CLPX_SALSV | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Salmonella schwarzengrund (strain CVM19633) GN=clpX PE=3 SV=1 | 178 | 459 | 3.0E-49 |
| sp|B5BD82|CLPX_SALPK | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Salmonella paratyphi A (strain AKU_12601) GN=clpX PE=3 SV=1 | 178 | 459 | 3.0E-49 |
| sp|C0Q7X4|CLPX_SALPC | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Salmonella paratyphi C (strain RKS4594) GN=clpX PE=3 SV=1 | 178 | 459 | 3.0E-49 |
| sp|A9MWX5|CLPX_SALPB | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=clpX PE=3 SV=1 | 178 | 459 | 3.0E-49 |
| sp|Q5PFN5|CLPX_SALPA | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=clpX PE=3 SV=1 | 178 | 459 | 3.0E-49 |
| sp|B4SWU2|CLPX_SALNS | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Salmonella newport (strain SL254) GN=clpX PE=3 SV=1 | 178 | 459 | 3.0E-49 |
| sp|B4T9E4|CLPX_SALHS | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Salmonella heidelberg (strain SL476) GN=clpX PE=3 SV=1 | 178 | 459 | 3.0E-49 |
| sp|B5R6V0|CLPX_SALG2 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=clpX PE=3 SV=1 | 178 | 459 | 3.0E-49 |
| sp|B5FKV4|CLPX_SALDC | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Salmonella dublin (strain CT_02021853) GN=clpX PE=3 SV=1 | 178 | 459 | 3.0E-49 |
| sp|Q57SB4|CLPX_SALCH | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Salmonella choleraesuis (strain SC-B67) GN=clpX PE=3 SV=1 | 178 | 459 | 3.0E-49 |
| sp|B5EXI9|CLPX_SALA4 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Salmonella agona (strain SL483) GN=clpX PE=3 SV=1 | 178 | 459 | 3.0E-49 |
| sp|P0DA37|CLPX_STRPQ | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=clpX PE=3 SV=1 | 183 | 459 | 3.0E-49 |
| sp|Q48U22|CLPX_STRPM | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=clpX PE=3 SV=1 | 183 | 459 | 3.0E-49 |
| sp|Q1J741|CLPX_STRPF | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=clpX PE=3 SV=1 | 183 | 459 | 3.0E-49 |
| sp|Q1JHC2|CLPX_STRPD | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=clpX PE=3 SV=1 | 183 | 459 | 3.0E-49 |
| sp|P63795|CLPX_STRP8 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=clpX PE=3 SV=1 | 183 | 459 | 3.0E-49 |
| sp|P0DA36|CLPX_STRP3 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=clpX PE=3 SV=1 | 183 | 459 | 3.0E-49 |
| sp|P63793|CLPX_STRP1 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus pyogenes serotype M1 GN=clpX PE=3 SV=1 | 183 | 459 | 3.0E-49 |
| sp|B5E6L2|CLPX_STRP4 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=clpX PE=3 SV=1 | 181 | 459 | 3.0E-49 |
| sp|Q7VRH0|CLPX_BLOFL | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Blochmannia floridanus GN=clpX PE=3 SV=1 | 75 | 444 | 3.0E-49 |
| sp|C1CLR8|CLPX_STRZP | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus pneumoniae (strain P1031) GN=clpX PE=3 SV=1 | 181 | 459 | 3.0E-49 |
| sp|C1CFF2|CLPX_STRZJ | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus pneumoniae (strain JJA) GN=clpX PE=3 SV=1 | 181 | 459 | 3.0E-49 |
| sp|P63792|CLPX_STRR6 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=clpX PE=3 SV=1 | 181 | 459 | 3.0E-49 |
| sp|P63791|CLPX_STRPN | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=clpX PE=3 SV=1 | 181 | 459 | 3.0E-49 |
| sp|C1C8G0|CLPX_STRP7 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus pneumoniae (strain 70585) GN=clpX PE=3 SV=1 | 181 | 459 | 3.0E-49 |
| sp|Q04JH9|CLPX_STRP2 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=clpX PE=3 SV=1 | 181 | 459 | 3.0E-49 |
| sp|B1MXT8|CLPX_LEUCK | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Leuconostoc citreum (strain KM20) GN=clpX PE=3 SV=1 | 177 | 455 | 3.0E-49 |
| sp|Q8CNY5|CLPX_STAES | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Staphylococcus epidermidis (strain ATCC 12228) GN=clpX PE=3 SV=1 | 183 | 469 | 4.0E-49 |
| sp|Q5HNM9|CLPX_STAEQ | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=clpX PE=3 SV=1 | 183 | 469 | 4.0E-49 |
| sp|Q3Z4W5|CLPX_SHISS | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shigella sonnei (strain Ss046) GN=clpX PE=3 SV=1 | 185 | 459 | 4.0E-49 |
| sp|P0A6H4|CLPX_SHIFL | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shigella flexneri GN=clpX PE=3 SV=2 | 185 | 459 | 4.0E-49 |
| sp|Q0T7E5|CLPX_SHIF8 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shigella flexneri serotype 5b (strain 8401) GN=clpX PE=3 SV=1 | 185 | 459 | 4.0E-49 |
| sp|Q32JJ4|CLPX_SHIDS | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=clpX PE=3 SV=1 | 185 | 459 | 4.0E-49 |
| sp|B2U4P3|CLPX_SHIB3 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=clpX PE=3 SV=1 | 185 | 459 | 4.0E-49 |
| sp|Q1RF97|CLPX_ECOUT | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli (strain UTI89 / UPEC) GN=clpX PE=3 SV=1 | 185 | 459 | 4.0E-49 |
| sp|B1LJJ5|CLPX_ECOSM | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=clpX PE=3 SV=1 | 185 | 459 | 4.0E-49 |
| sp|B6HZP5|CLPX_ECOSE | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli (strain SE11) GN=clpX PE=3 SV=1 | 185 | 459 | 4.0E-49 |
| sp|B7N8Z2|CLPX_ECOLU | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=clpX PE=3 SV=1 | 185 | 459 | 4.0E-49 |
| sp|P0A6H1|CLPX_ECOLI | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli (strain K12) GN=clpX PE=1 SV=2 | 185 | 459 | 4.0E-49 |
| sp|B1J010|CLPX_ECOLC | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=clpX PE=3 SV=1 | 185 | 459 | 4.0E-49 |
| sp|P0A6H2|CLPX_ECOL6 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=clpX PE=3 SV=2 | 185 | 459 | 4.0E-49 |
| sp|Q0TKK3|CLPX_ECOL5 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=clpX PE=3 SV=1 | 185 | 459 | 4.0E-49 |
| sp|A1A8A7|CLPX_ECOK1 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli O1:K1 / APEC GN=clpX PE=3 SV=1 | 185 | 459 | 4.0E-49 |
| sp|A7ZX96|CLPX_ECOHS | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli O9:H4 (strain HS) GN=clpX PE=3 SV=1 | 185 | 459 | 4.0E-49 |
| sp|B1XFM6|CLPX_ECODH | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli (strain K12 / DH10B) GN=clpX PE=3 SV=1 | 185 | 459 | 4.0E-49 |
| sp|C4ZTJ5|CLPX_ECOBW | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=clpX PE=3 SV=1 | 185 | 459 | 4.0E-49 |
| sp|B7M3T1|CLPX_ECO8A | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli O8 (strain IAI1) GN=clpX PE=3 SV=1 | 185 | 459 | 4.0E-49 |
| sp|B7MQF4|CLPX_ECO81 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli O81 (strain ED1a) GN=clpX PE=3 SV=1 | 185 | 459 | 4.0E-49 |
| sp|B7NJ56|CLPX_ECO7I | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=clpX PE=3 SV=1 | 185 | 459 | 4.0E-49 |
| sp|B5Z3U5|CLPX_ECO5E | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=clpX PE=3 SV=1 | 185 | 459 | 4.0E-49 |
| sp|P0A6H3|CLPX_ECO57 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli O157:H7 GN=clpX PE=3 SV=2 | 185 | 459 | 4.0E-49 |
| sp|B7L675|CLPX_ECO55 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli (strain 55989 / EAEC) GN=clpX PE=3 SV=1 | 185 | 459 | 4.0E-49 |
| sp|B7MD97|CLPX_ECO45 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=clpX PE=3 SV=1 | 185 | 459 | 4.0E-49 |
| sp|B7UJR1|CLPX_ECO27 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=clpX PE=3 SV=1 | 185 | 459 | 4.0E-49 |
| sp|A7ZIJ6|CLPX_ECO24 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=clpX PE=3 SV=1 | 185 | 459 | 4.0E-49 |
| sp|A9NDF9|CLPX_COXBR | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=clpX PE=3 SV=1 | 147 | 443 | 4.0E-49 |
| sp|A5FX05|CLPX_ACICJ | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Acidiphilium cryptum (strain JF-5) GN=clpX PE=3 SV=1 | 181 | 443 | 4.0E-49 |
| sp|Q820F8|CLPX_STRAW | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=clpX PE=3 SV=1 | 180 | 468 | 4.0E-49 |
| sp|Q1MQ78|CLPX_LAWIP | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=clpX PE=3 SV=1 | 174 | 444 | 4.0E-49 |
| sp|A9KSX1|CLPX_CLOPH | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=clpX PE=3 SV=1 | 179 | 459 | 4.0E-49 |
| sp|Q07ZX9|CLPX_SHEFN | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shewanella frigidimarina (strain NCIMB 400) GN=clpX PE=3 SV=1 | 185 | 456 | 5.0E-49 |
| sp|Q4L715|CLPX_STAHJ | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Staphylococcus haemolyticus (strain JCSC1435) GN=clpX PE=3 SV=1 | 183 | 474 | 5.0E-49 |
| sp|Q83DJ1|CLPX_COXBU | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=clpX PE=3 SV=1 | 147 | 443 | 6.0E-49 |
| sp|B6J0V9|CLPX_COXB2 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Coxiella burnetii (strain CbuG_Q212) GN=clpX PE=3 SV=1 | 147 | 443 | 6.0E-49 |
| sp|B6J8W3|CLPX_COXB1 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Coxiella burnetii (strain CbuK_Q154) GN=clpX PE=3 SV=1 | 147 | 443 | 6.0E-49 |
| sp|Q24SJ9|CLPX_DESHY | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Desulfitobacterium hafniense (strain Y51) GN=clpX PE=3 SV=1 | 181 | 444 | 6.0E-49 |
| sp|B8FVI0|CLPX_DESHD | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=clpX PE=3 SV=1 | 181 | 444 | 6.0E-49 |
| sp|A1B1H7|CLPX_PARDP | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Paracoccus denitrificans (strain Pd 1222) GN=clpX PE=3 SV=1 | 174 | 443 | 6.0E-49 |
| sp|A7Z7B2|CLPX_BACMF | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=clpX PE=3 SV=1 | 138 | 467 | 6.0E-49 |
| sp|Q5NH46|CLPX_FRATT | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=clpX PE=3 SV=1 | 178 | 444 | 6.0E-49 |
| sp|Q65GJ4|CLPX_BACLD | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=clpX PE=3 SV=1 | 138 | 467 | 6.0E-49 |
| sp|Q66DT3|CLPX_YERPS | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=clpX PE=3 SV=1 | 178 | 456 | 7.0E-49 |
| sp|B8E291|CLPX_DICTD | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=clpX PE=3 SV=1 | 183 | 444 | 7.0E-49 |
| sp|Q5WEN9|CLPX_BACSK | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bacillus clausii (strain KSM-K16) GN=clpX PE=3 SV=1 | 120 | 444 | 7.0E-49 |
| sp|A9KDS7|CLPX_COXBN | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Coxiella burnetii (strain Dugway 5J108-111) GN=clpX PE=3 SV=1 | 147 | 443 | 8.0E-49 |
| sp|B4U360|CLPX_STREM | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=clpX PE=3 SV=1 | 183 | 459 | 8.0E-49 |
| sp|Q8Z8V1|CLPX_SALTI | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Salmonella typhi GN=clpX PE=3 SV=1 | 178 | 459 | 8.0E-49 |
| sp|Q12LA2|CLPX_SHEDO | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=clpX PE=3 SV=1 | 171 | 456 | 1.0E-48 |
| sp|B5XL03|CLPX_STRPZ | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=clpX PE=3 SV=1 | 183 | 459 | 1.0E-48 |
| sp|A2RF17|CLPX_STRPG | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=clpX PE=3 SV=1 | 183 | 459 | 1.0E-48 |
| sp|C5CAX2|CLPX_MICLC | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=clpX PE=3 SV=1 | 185 | 456 | 1.0E-48 |
| sp|C0M9R7|CLPX_STRE4 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus equi subsp. equi (strain 4047) GN=clpX PE=3 SV=1 | 183 | 459 | 1.0E-48 |
| sp|B6JGU8|CLPX_OLICO | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=clpX PE=3 SV=1 | 180 | 466 | 1.0E-48 |
| sp|Q2RU44|CLPX_RHORT | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=clpX PE=3 SV=1 | 171 | 443 | 1.0E-48 |
| sp|Q1JM77|CLPX_STRPC | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=clpX PE=3 SV=1 | 183 | 459 | 1.0E-48 |
| sp|Q1JC93|CLPX_STRPB | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=clpX PE=3 SV=1 | 183 | 459 | 1.0E-48 |
| sp|B5YE53|CLPX_DICT6 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=clpX PE=3 SV=1 | 183 | 444 | 1.0E-48 |
| sp|A4XTZ6|CLPX_PSEMY | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Pseudomonas mendocina (strain ymp) GN=clpX PE=3 SV=1 | 181 | 459 | 1.0E-48 |
| sp|Q5XCM0|CLPX_STRP6 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=clpX PE=3 SV=1 | 183 | 459 | 1.0E-48 |
| sp|B2IGP2|CLPX_BEII9 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=clpX PE=3 SV=1 | 171 | 463 | 1.0E-48 |
| sp|C0MEW5|CLPX_STRS7 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=clpX PE=3 SV=1 | 183 | 459 | 1.0E-48 |
| sp|Q03F27|CLPX_PEDPA | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=clpX PE=3 SV=1 | 175 | 444 | 1.0E-48 |
| sp|Q21KA8|CLPX_SACD2 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=clpX PE=3 SV=1 | 183 | 444 | 1.0E-48 |
| sp|A9HRV3|CLPX_GLUDA | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=clpX PE=3 SV=1 | 179 | 443 | 1.0E-48 |
| sp|Q67SJ9|CLPX_SYMTH | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=clpX PE=3 SV=1 | 180 | 479 | 1.0E-48 |
| sp|Q5QXN9|CLPX_IDILO | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=clpX PE=3 SV=1 | 180 | 456 | 2.0E-48 |
| sp|Q2RL30|CLPX_MOOTA | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Moorella thermoacetica (strain ATCC 39073) GN=clpX PE=3 SV=1 | 181 | 444 | 2.0E-48 |
| sp|Q60BE7|CLPX2_METCA | ATP-dependent Clp protease ATP-binding subunit ClpX 2 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=clpX2 PE=3 SV=1 | 138 | 456 | 2.0E-48 |
| sp|Q5ZUE0|CLPX_LEGPH | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=clpX PE=3 SV=2 | 185 | 459 | 2.0E-48 |
| sp|B9E684|CLPX_CLOK1 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Clostridium kluyveri (strain NBRC 12016) GN=clpX PE=3 SV=1 | 185 | 444 | 2.0E-48 |
| sp|A5V3U4|CLPX_SPHWW | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=clpX PE=3 SV=1 | 180 | 444 | 2.0E-48 |
| sp|B9DU73|CLPX_STRU0 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=clpX PE=3 SV=1 | 183 | 459 | 2.0E-48 |
| sp|A8GPK1|CLPX_RICAH | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rickettsia akari (strain Hartford) GN=clpX PE=3 SV=1 | 185 | 456 | 2.0E-48 |
| sp|A1W5B7|CLPX_ACISJ | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Acidovorax sp. (strain JS42) GN=clpX PE=3 SV=1 | 177 | 444 | 2.0E-48 |
| sp|B9MG15|CLPX_ACIET | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Acidovorax ebreus (strain TPSY) GN=clpX PE=3 SV=1 | 177 | 444 | 2.0E-48 |
| sp|B8EIL3|CLPX_METSB | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=clpX PE=3 SV=1 | 171 | 463 | 2.0E-48 |
| sp|Q5SKM7|CLPX_THET8 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=clpX PE=3 SV=1 | 186 | 443 | 2.0E-48 |
| sp|A8LJA7|CLPX_DINSH | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=clpX PE=3 SV=1 | 185 | 443 | 2.0E-48 |
| sp|A5CDP2|CLPX_ORITB | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Orientia tsutsugamushi (strain Boryong) GN=clpX PE=3 SV=1 | 187 | 459 | 2.0E-48 |
| sp|C3JYJ9|CLPX_PSEFS | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Pseudomonas fluorescens (strain SBW25) GN=clpX PE=3 SV=1 | 181 | 463 | 2.0E-48 |
| sp|O84711|CLPX_CHLTR | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=clpX PE=3 SV=1 | 183 | 444 | 2.0E-48 |
| sp|A0AI71|CLPX_LISW6 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=clpX PE=3 SV=1 | 178 | 469 | 2.0E-48 |
| sp|B0BAG0|CLPX_CHLTB | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=clpX PE=3 SV=1 | 183 | 444 | 2.0E-48 |
| sp|B0B8T1|CLPX_CHLT2 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=clpX PE=3 SV=1 | 183 | 444 | 2.0E-48 |
| sp|Q0VQ89|CLPX_ALCBS | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=clpX PE=3 SV=1 | 183 | 456 | 2.0E-48 |
| sp|A5N2K7|CLPX_CLOK5 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=clpX PE=3 SV=1 | 185 | 444 | 3.0E-48 |
| sp|B7GH25|CLPX_ANOFW | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=clpX PE=3 SV=1 | 138 | 467 | 3.0E-48 |
| sp|A8GVR9|CLPX_RICB8 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rickettsia bellii (strain OSU 85-389) GN=clpX PE=3 SV=1 | 185 | 456 | 3.0E-48 |
| sp|Q5R7N3|CLPX_PONAB | ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial OS=Pongo abelii GN=CLPX PE=2 SV=1 | 82 | 371 | 3.0E-48 |
| sp|B1JHS0|CLPX_YERPY | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=clpX PE=3 SV=1 | 178 | 456 | 3.0E-48 |
| sp|A4TPE2|CLPX_YERPP | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Yersinia pestis (strain Pestoides F) GN=clpX PE=3 SV=1 | 178 | 456 | 3.0E-48 |
| sp|Q1CL64|CLPX_YERPN | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=clpX PE=3 SV=1 | 178 | 456 | 3.0E-48 |
| sp|A9QZQ2|CLPX_YERPG | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Yersinia pestis bv. Antiqua (strain Angola) GN=clpX PE=3 SV=1 | 178 | 456 | 3.0E-48 |
| sp|Q8ZC66|CLPX_YERPE | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Yersinia pestis GN=clpX PE=3 SV=1 | 178 | 456 | 3.0E-48 |
| sp|B2K6V8|CLPX_YERPB | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=clpX PE=3 SV=1 | 178 | 456 | 3.0E-48 |
| sp|Q1C4K9|CLPX_YERPA | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=clpX PE=3 SV=1 | 178 | 456 | 3.0E-48 |
| sp|A7FLC3|CLPX_YERP3 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=clpX PE=3 SV=1 | 178 | 456 | 3.0E-48 |
| sp|Q5HBX4|CLPX_EHRRW | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Ehrlichia ruminantium (strain Welgevonden) GN=clpX PE=3 SV=1 | 138 | 446 | 3.0E-48 |
| sp|Q5FFG6|CLPX_EHRRG | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Ehrlichia ruminantium (strain Gardel) GN=clpX PE=3 SV=1 | 138 | 446 | 3.0E-48 |
| sp|Q97FT7|CLPX_CLOAB | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=clpX PE=3 SV=1 | 178 | 454 | 3.0E-48 |
| sp|Q1RJ84|CLPX_RICBR | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rickettsia bellii (strain RML369-C) GN=clpX PE=3 SV=1 | 185 | 456 | 3.0E-48 |
| sp|B4EU54|CLPX_PROMH | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Proteus mirabilis (strain HI4320) GN=clpX PE=3 SV=1 | 171 | 456 | 3.0E-48 |
| sp|B0KJG7|CLPX_PSEPG | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Pseudomonas putida (strain GB-1) GN=clpX PE=3 SV=1 | 181 | 456 | 3.0E-48 |
| sp|Q6D826|CLPX_PECAS | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=clpX PE=3 SV=1 | 185 | 465 | 3.0E-48 |
| sp|A4WSH9|CLPX_RHOS5 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=clpX PE=3 SV=1 | 174 | 443 | 3.0E-48 |
| sp|Q2SK35|CLPX_HAHCH | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Hahella chejuensis (strain KCTC 2396) GN=clpX PE=3 SV=1 | 181 | 456 | 4.0E-48 |
| sp|Q3K9X0|CLPX_PSEPF | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Pseudomonas fluorescens (strain Pf0-1) GN=clpX PE=3 SV=1 | 181 | 463 | 4.0E-48 |
| sp|O76031|CLPX_HUMAN | ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial OS=Homo sapiens GN=CLPX PE=1 SV=2 | 82 | 371 | 4.0E-48 |
| sp|Q3KKY9|CLPX_CHLTA | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=clpX PE=3 SV=1 | 189 | 444 | 4.0E-48 |
| sp|A5W634|CLPX_PSEP1 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=clpX PE=3 SV=1 | 181 | 456 | 4.0E-48 |
| sp|C5BTX7|CLPX_TERTT | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=clpX PE=3 SV=1 | 183 | 444 | 4.0E-48 |
| sp|A8EZR2|CLPX_RICCK | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rickettsia canadensis (strain McKiel) GN=clpX PE=3 SV=1 | 184 | 440 | 5.0E-48 |
| sp|Q325G3|CLPX_SHIBS | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shigella boydii serotype 4 (strain Sb227) GN=clpX PE=3 SV=1 | 185 | 459 | 5.0E-48 |
| sp|B0SZ62|CLPX_CAUSK | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Caulobacter sp. (strain K31) GN=clpX PE=3 SV=1 | 171 | 444 | 5.0E-48 |
| sp|Q8E4L8|CLPX_STRA3 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus agalactiae serotype III (strain NEM316) GN=clpX PE=3 SV=1 | 180 | 459 | 5.0E-48 |
| sp|Q3K0K0|CLPX_STRA1 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=clpX PE=3 SV=1 | 180 | 459 | 5.0E-48 |
| sp|B1VXA8|CLPX_STRGG | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=clpX PE=3 SV=1 | 179 | 444 | 5.0E-48 |
| sp|Q8DZ10|CLPX_STRA5 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=clpX PE=3 SV=1 | 180 | 459 | 5.0E-48 |
| sp|B9KJU8|CLPX_RHOSK | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=clpX PE=3 SV=1 | 174 | 443 | 5.0E-48 |
| sp|A3PKS0|CLPX_RHOS1 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=clpX PE=3 SV=1 | 174 | 443 | 5.0E-48 |
| sp|A8FFV9|CLPX_BACP2 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bacillus pumilus (strain SAFR-032) GN=clpX PE=3 SV=1 | 138 | 467 | 5.0E-48 |
| sp|B1J693|CLPX_PSEPW | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Pseudomonas putida (strain W619) GN=clpX PE=3 SV=1 | 181 | 456 | 5.0E-48 |
| sp|A9KWH8|CLPX_SHEB9 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shewanella baltica (strain OS195) GN=clpX PE=3 SV=1 | 171 | 456 | 5.0E-48 |
| sp|A3D306|CLPX_SHEB5 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=clpX PE=3 SV=1 | 171 | 456 | 5.0E-48 |
| sp|B8E5E8|CLPX_SHEB2 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shewanella baltica (strain OS223) GN=clpX PE=3 SV=1 | 171 | 456 | 5.0E-48 |
| sp|O33873|CLPX_YEREN | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Yersinia enterocolitica GN=clpX PE=3 SV=1 | 178 | 456 | 5.0E-48 |
| sp|A1JNN1|CLPX_YERE8 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=clpX PE=3 SV=1 | 178 | 456 | 5.0E-48 |
| sp|A6WLQ2|CLPX_SHEB8 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shewanella baltica (strain OS185) GN=clpX PE=3 SV=1 | 171 | 456 | 5.0E-48 |
| sp|C6DB56|CLPX_PECCP | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=clpX PE=3 SV=1 | 185 | 465 | 6.0E-48 |
| sp|B1Y6H2|CLPX_LEPCP | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=clpX PE=3 SV=1 | 178 | 443 | 6.0E-48 |
| sp|A0LDT3|CLPX_MAGMM | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=clpX PE=3 SV=1 | 171 | 444 | 6.0E-48 |
| sp|Q8DLI1|CLPX_THEEB | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Thermosynechococcus elongatus (strain BP-1) GN=clpX PE=3 SV=1 | 183 | 444 | 6.0E-48 |
| sp|Q74JU4|CLPX_LACJO | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=clpX PE=3 SV=1 | 186 | 444 | 6.0E-48 |
| sp|A4XAH9|CLPX_SALTO | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=clpX PE=3 SV=1 | 177 | 444 | 6.0E-48 |
| sp|A8GAR0|CLPX_SERP5 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Serratia proteamaculans (strain 568) GN=clpX PE=3 SV=1 | 178 | 459 | 7.0E-48 |
| sp|Q8DUI0|CLPX_STRMU | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=clpX PE=3 SV=1 | 183 | 459 | 7.0E-48 |
| sp|Q6LNW1|CLPX_PHOPR | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Photobacterium profundum GN=clpX PE=3 SV=1 | 185 | 456 | 7.0E-48 |
| sp|B1YJW0|CLPX_EXIS2 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=clpX PE=3 SV=1 | 181 | 470 | 7.0E-48 |
| sp|Q88KI9|CLPX_PSEPK | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Pseudomonas putida (strain KT2440) GN=clpX PE=3 SV=1 | 181 | 456 | 7.0E-48 |
| sp|C4LJV6|CLPX_CORK4 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=clpX PE=3 SV=1 | 183 | 458 | 8.0E-48 |
| sp|C5D5L4|CLPX_GEOSW | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Geobacillus sp. (strain WCH70) GN=clpX PE=3 SV=1 | 138 | 467 | 8.0E-48 |
| sp|Q72L14|CLPX_THET2 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=clpX PE=3 SV=1 | 186 | 443 | 8.0E-48 |
| sp|Q8Y7K9|CLPX_LISMO | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=clpX PE=3 SV=1 | 178 | 469 | 8.0E-48 |
| sp|B8DHN7|CLPX_LISMH | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=clpX PE=3 SV=1 | 178 | 469 | 8.0E-48 |
| sp|Q720F3|CLPX_LISMF | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Listeria monocytogenes serotype 4b (strain F2365) GN=clpX PE=3 SV=1 | 178 | 469 | 8.0E-48 |
| sp|C1L2H6|CLPX_LISMC | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=clpX PE=3 SV=1 | 178 | 469 | 8.0E-48 |
| sp|Q5P160|CLPX_AROAE | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Aromatoleum aromaticum (strain EbN1) GN=clpX PE=3 SV=1 | 179 | 444 | 8.0E-48 |
| sp|A1RL88|CLPX_SHESW | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shewanella sp. (strain W3-18-1) GN=clpX PE=3 SV=1 | 171 | 456 | 8.0E-48 |
| sp|A4Y5I3|CLPX_SHEPC | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=clpX PE=3 SV=1 | 171 | 456 | 8.0E-48 |
| sp|C0ZAG3|CLPX_BREBN | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=clpX PE=3 SV=1 | 120 | 468 | 8.0E-48 |
| sp|B8GNT9|CLPX_THISH | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=clpX PE=3 SV=1 | 171 | 459 | 8.0E-48 |
| sp|Q92C84|CLPX_LISIN | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=clpX PE=3 SV=1 | 178 | 469 | 8.0E-48 |
| sp|Q9F316|CLPX_STRCO | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=clpX PE=3 SV=1 | 180 | 444 | 9.0E-48 |
| sp|Q2GJB5|CLPX_ANAPZ | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Anaplasma phagocytophilum (strain HZ) GN=clpX PE=3 SV=1 | 130 | 465 | 9.0E-48 |
| sp|B3CQC6|CLPX_ORITI | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Orientia tsutsugamushi (strain Ikeda) GN=clpX PE=3 SV=1 | 187 | 459 | 1.0E-47 |
| sp|Q472D2|CLPX_CUPPJ | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=clpX PE=3 SV=1 | 171 | 456 | 1.0E-47 |
| sp|Q5KWJ9|CLPX_GEOKA | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Geobacillus kaustophilus (strain HTA426) GN=clpX PE=3 SV=1 | 141 | 474 | 1.0E-47 |
| sp|Q9WXZ3|CLPX_THEMA | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=clpX PE=3 SV=1 | 185 | 459 | 1.0E-47 |
| sp|Q03W09|CLPX_LEUMM | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=clpX PE=3 SV=1 | 75 | 459 | 1.0E-47 |
| sp|B3PHK5|CLPX_CELJU | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Cellvibrio japonicus (strain Ueda107) GN=clpX PE=3 SV=1 | 183 | 444 | 1.0E-47 |
| sp|Q8EG18|CLPX_SHEON | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shewanella oneidensis (strain MR-1) GN=clpX PE=3 SV=1 | 171 | 456 | 1.0E-47 |
| sp|A0KYL8|CLPX_SHESA | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shewanella sp. (strain ANA-3) GN=clpX PE=3 SV=1 | 171 | 456 | 1.0E-47 |
| sp|Q9JHS4|CLPX_MOUSE | ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial OS=Mus musculus GN=Clpx PE=1 SV=2 | 82 | 371 | 1.0E-47 |
| sp|A8M1K7|CLPX_SALAI | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Salinispora arenicola (strain CNS-205) GN=clpX PE=3 SV=1 | 183 | 454 | 1.0E-47 |
| sp|Q0HTK8|CLPX_SHESR | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shewanella sp. (strain MR-7) GN=clpX PE=3 SV=1 | 171 | 456 | 1.0E-47 |
| sp|Q0HHA2|CLPX_SHESM | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shewanella sp. (strain MR-4) GN=clpX PE=3 SV=1 | 171 | 456 | 1.0E-47 |
| sp|B5EQ29|CLPX_ACIF5 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=clpX PE=3 SV=1 | 171 | 444 | 2.0E-47 |
| sp|B7J791|CLPX_ACIF2 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=clpX PE=3 SV=1 | 171 | 444 | 2.0E-47 |
| sp|Q9JTX8|CLPX_NEIMA | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=clpX PE=3 SV=1 | 184 | 443 | 2.0E-47 |
| sp|B7KBH7|CLPX_CYAP7 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Cyanothece sp. (strain PCC 7424) GN=clpX PE=3 SV=1 | 185 | 444 | 2.0E-47 |
| sp|B7JW74|CLPX_CYAP8 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Cyanothece sp. (strain PCC 8801) GN=clpX PE=3 SV=1 | 176 | 444 | 2.0E-47 |
| sp|Q1Q8J1|CLPX_PSYCK | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Psychrobacter cryohalolentis (strain K5) GN=clpX PE=3 SV=1 | 185 | 454 | 2.0E-47 |
| sp|Q8RHJ9|CLPX_FUSNN | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=clpX PE=3 SV=1 | 185 | 444 | 2.0E-47 |
| sp|Q9JYY3|CLPX_NEIMB | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Neisseria meningitidis serogroup B (strain MC58) GN=clpX PE=3 SV=1 | 184 | 443 | 2.0E-47 |
| sp|A1KUJ4|CLPX_NEIMF | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=clpX PE=3 SV=1 | 184 | 443 | 2.0E-47 |
| sp|Q3J1G7|CLPX_RHOS4 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=clpX PE=3 SV=1 | 174 | 443 | 2.0E-47 |
| sp|Q4FQB8|CLPX_PSYA2 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=clpX PE=3 SV=1 | 185 | 454 | 2.0E-47 |
| sp|Q3JAJ9|CLPX_NITOC | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=clpX PE=3 SV=1 | 181 | 456 | 2.0E-47 |
| sp|Q0C0G0|CLPX_HYPNA | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Hyphomonas neptunium (strain ATCC 15444) GN=clpX PE=3 SV=1 | 171 | 443 | 2.0E-47 |
| sp|B4RCN8|CLPX_PHEZH | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Phenylobacterium zucineum (strain HLK1) GN=clpX PE=3 SV=1 | 171 | 444 | 2.0E-47 |
| sp|A9M020|CLPX_NEIM0 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Neisseria meningitidis serogroup C (strain 053442) GN=clpX PE=3 SV=1 | 184 | 443 | 2.0E-47 |
| sp|Q2L255|CLPX_BORA1 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bordetella avium (strain 197N) GN=clpX PE=3 SV=1 | 181 | 444 | 2.0E-47 |
| sp|C4LDB4|CLPX_TOLAT | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=clpX PE=3 SV=1 | 180 | 456 | 2.0E-47 |
| sp|Q89AA0|CLPX_BUCBP | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=clpX PE=3 SV=1 | 170 | 454 | 2.0E-47 |
| sp|Q63V40|CLPX_BURPS | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Burkholderia pseudomallei (strain K96243) GN=clpX PE=3 SV=2 | 171 | 456 | 2.0E-47 |
| sp|A3NAI4|CLPX_BURP6 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Burkholderia pseudomallei (strain 668) GN=clpX PE=3 SV=1 | 171 | 456 | 2.0E-47 |
| sp|A3NWA5|CLPX_BURP0 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Burkholderia pseudomallei (strain 1106a) GN=clpX PE=3 SV=1 | 171 | 456 | 2.0E-47 |
| sp|A1S4X6|CLPX_SHEAM | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=clpX PE=3 SV=1 | 185 | 456 | 2.0E-47 |
| sp|B8FA63|CLPX_DESAA | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Desulfatibacillum alkenivorans (strain AK-01) GN=clpX PE=3 SV=1 | 140 | 466 | 2.0E-47 |
| sp|P44838|CLPX_HAEIN | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=clpX PE=3 SV=1 | 75 | 444 | 2.0E-47 |
| sp|Q15R47|CLPX_PSEA6 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=clpX PE=3 SV=1 | 185 | 459 | 2.0E-47 |
| sp|A4W7A9|CLPX_ENT38 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Enterobacter sp. (strain 638) GN=clpX PE=3 SV=1 | 185 | 459 | 3.0E-47 |
| sp|Q7NUZ0|CLPX_CHRVO | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=clpX PE=3 SV=1 | 183 | 444 | 3.0E-47 |
| sp|C4K2L5|CLPX_RICPU | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rickettsia peacockii (strain Rustic) GN=clpX PE=3 SV=1 | 185 | 440 | 3.0E-47 |
| sp|Q5H433|CLPX_XANOR | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=clpX PE=3 SV=1 | 171 | 455 | 3.0E-47 |
| sp|Q2P6Y9|CLPX_XANOM | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=clpX PE=3 SV=1 | 171 | 455 | 3.0E-47 |
| sp|A1TM61|CLPX_ACIAC | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Acidovorax citrulli (strain AAC00-1) GN=clpX PE=3 SV=1 | 177 | 443 | 3.0E-47 |
| sp|A8GTC4|CLPX_RICRS | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rickettsia rickettsii (strain Sheila Smith) GN=clpX PE=3 SV=1 | 185 | 456 | 3.0E-47 |
| sp|B0BUW3|CLPX_RICRO | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rickettsia rickettsii (strain Iowa) GN=clpX PE=3 SV=1 | 185 | 456 | 3.0E-47 |
| sp|Q2NV78|CLPX_SODGM | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Sodalis glossinidius (strain morsitans) GN=clpX PE=3 SV=1 | 185 | 465 | 3.0E-47 |
| sp|B4U6S1|CLPX_HYDS0 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=clpX PE=3 SV=1 | 95 | 444 | 3.0E-47 |
| sp|A4JF04|CLPX_BURVG | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=clpX PE=3 SV=1 | 171 | 456 | 3.0E-47 |
| sp|A1K782|CLPX_AZOSB | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Azoarcus sp. (strain BH72) GN=clpX PE=3 SV=1 | 179 | 443 | 4.0E-47 |
| sp|B2SMI2|CLPX_XANOP | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=clpX PE=3 SV=1 | 171 | 455 | 4.0E-47 |
| sp|A5VJ94|CLPX_LACRD | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Lactobacillus reuteri (strain DSM 20016) GN=clpX PE=3 SV=1 | 186 | 466 | 4.0E-47 |
| sp|B2JGL6|CLPX_BURP8 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=clpX PE=3 SV=1 | 171 | 456 | 4.0E-47 |
| sp|Q0KBK3|CLPX_CUPNH | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=clpX PE=3 SV=1 | 171 | 456 | 4.0E-47 |
| sp|Q2SWQ5|CLPX_BURTA | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=clpX PE=3 SV=1 | 171 | 456 | 4.0E-47 |
| sp|A9AJR1|CLPX_BURM1 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=clpX PE=3 SV=1 | 171 | 456 | 4.0E-47 |
| sp|Q8PBY5|CLPX_XANCP | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=clpX PE=3 SV=1 | 171 | 444 | 4.0E-47 |
| sp|B0RTF5|CLPX_XANCB | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Xanthomonas campestris pv. campestris (strain B100) GN=clpX PE=3 SV=1 | 171 | 444 | 4.0E-47 |
| sp|Q4URL5|CLPX_XANC8 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Xanthomonas campestris pv. campestris (strain 8004) GN=clpX PE=3 SV=1 | 171 | 444 | 4.0E-47 |
| sp|Q9PLM1|CLPX_CHLMU | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Chlamydia muridarum (strain MoPn / Nigg) GN=clpX PE=3 SV=1 | 183 | 444 | 4.0E-47 |
| sp|Q39FE9|CLPX_BURL3 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=clpX PE=3 SV=1 | 171 | 456 | 5.0E-47 |
| sp|B4EBM2|CLPX_BURCJ | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=clpX PE=3 SV=1 | 171 | 456 | 5.0E-47 |
| sp|A0K846|CLPX_BURCH | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Burkholderia cenocepacia (strain HI2424) GN=clpX PE=3 SV=1 | 171 | 456 | 5.0E-47 |
| sp|B1JTU9|CLPX_BURCC | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Burkholderia cenocepacia (strain MC0-3) GN=clpX PE=3 SV=1 | 171 | 456 | 5.0E-47 |
| sp|Q1BH84|CLPX_BURCA | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Burkholderia cenocepacia (strain AU 1054) GN=clpX PE=3 SV=1 | 171 | 456 | 5.0E-47 |
| sp|Q5U2U0|CLPX_RAT | ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial OS=Rattus norvegicus GN=Clpx PE=2 SV=1 | 82 | 371 | 5.0E-47 |
| sp|B1LW29|CLPX_METRJ | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=clpX PE=3 SV=1 | 180 | 466 | 5.0E-47 |
| sp|B0C146|CLPX_ACAM1 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Acaryochloris marina (strain MBIC 11017) GN=clpX PE=3 SV=1 | 183 | 444 | 5.0E-47 |
| sp|B4SLN2|CLPX_STRM5 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Stenotrophomonas maltophilia (strain R551-3) GN=clpX PE=3 SV=1 | 171 | 444 | 5.0E-47 |
| sp|Q3BWQ0|CLPX_XANC5 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=clpX PE=3 SV=1 | 171 | 444 | 5.0E-47 |
| sp|Q8PNI4|CLPX_XANAC | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Xanthomonas axonopodis pv. citri (strain 306) GN=clpX PE=3 SV=1 | 171 | 444 | 5.0E-47 |
| sp|Q8D347|CLPX_WIGBR | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Wigglesworthia glossinidia brevipalpis GN=clpX PE=3 SV=1 | 168 | 444 | 5.0E-47 |
| sp|B0V4T7|CLPX_ACIBY | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Acinetobacter baumannii (strain AYE) GN=clpX PE=3 SV=1 | 185 | 462 | 5.0E-47 |
| sp|A3M1Y8|CLPX_ACIBT | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=clpX PE=3 SV=2 | 185 | 462 | 5.0E-47 |
| sp|B0VKU4|CLPX_ACIBS | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Acinetobacter baumannii (strain SDF) GN=clpX PE=3 SV=1 | 185 | 462 | 5.0E-47 |
| sp|B2I3C2|CLPX_ACIBC | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Acinetobacter baumannii (strain ACICU) GN=clpX PE=3 SV=1 | 185 | 462 | 5.0E-47 |
| sp|B7I5E4|CLPX_ACIB5 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Acinetobacter baumannii (strain AB0057) GN=clpX PE=3 SV=1 | 185 | 462 | 5.0E-47 |
| sp|B7H092|CLPX_ACIB3 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Acinetobacter baumannii (strain AB307-0294) GN=clpX PE=3 SV=1 | 185 | 462 | 5.0E-47 |
| sp|B3R4W2|CLPX_CUPTR | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=clpX PE=3 SV=1 | 171 | 456 | 5.0E-47 |
| sp|A9W5F6|CLPX_METEP | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Methylobacterium extorquens (strain PA1) GN=clpX PE=3 SV=1 | 180 | 443 | 5.0E-47 |
| sp|B7KNT1|CLPX_METC4 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=clpX PE=3 SV=1 | 180 | 443 | 5.0E-47 |
| sp|Q1LM63|CLPX_CUPMC | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=clpX PE=3 SV=1 | 171 | 456 | 5.0E-47 |
| sp|B0U5N2|CLPX_XYLFM | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Xylella fastidiosa (strain M12) GN=clpX PE=3 SV=1 | 171 | 444 | 6.0E-47 |
| sp|B3QWK0|CLPX_CHLT3 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=clpX PE=3 SV=1 | 183 | 468 | 6.0E-47 |
| sp|Q03QN7|CLPX_LACBA | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=clpX PE=3 SV=1 | 75 | 444 | 6.0E-47 |
| sp|Q7M8U5|CLPX2_WOLSU | ATP-dependent Clp protease ATP-binding subunit ClpX 2 OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=clpX2 PE=3 SV=1 | 96 | 460 | 6.0E-47 |
| sp|A4IRH2|CLPX_GEOTN | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Geobacillus thermodenitrificans (strain NG80-2) GN=clpX PE=3 SV=1 | 141 | 444 | 6.0E-47 |
| sp|B2FQR3|CLPX_STRMK | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Stenotrophomonas maltophilia (strain K279a) GN=clpX PE=3 SV=1 | 171 | 444 | 7.0E-47 |
| sp|A5WC69|CLPX_PSYWF | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Psychrobacter sp. (strain PRwf-1) GN=clpX PE=3 SV=1 | 185 | 444 | 7.0E-47 |
| sp|P50866|CLPX_BACSU | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bacillus subtilis (strain 168) GN=clpX PE=2 SV=3 | 138 | 467 | 7.0E-47 |
| sp|A3QFX5|CLPX_SHELP | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=clpX PE=3 SV=1 | 171 | 456 | 7.0E-47 |
| sp|B2T404|CLPX_BURPP | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=clpX PE=3 SV=1 | 171 | 456 | 8.0E-47 |
| sp|B1XN45|CLPX_SYNP2 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=clpX PE=3 SV=1 | 185 | 444 | 8.0E-47 |
| sp|B1Z9C8|CLPX_METPB | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=clpX PE=3 SV=1 | 180 | 466 | 8.0E-47 |
| sp|Q9PE40|CLPX_XYLFA | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Xylella fastidiosa (strain 9a5c) GN=clpX PE=3 SV=1 | 171 | 444 | 8.0E-47 |
| sp|Q042T7|CLPX_LACGA | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=clpX PE=3 SV=1 | 186 | 444 | 8.0E-47 |
| sp|B2IT91|CLPX_NOSP7 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=clpX PE=3 SV=1 | 183 | 444 | 9.0E-47 |
| sp|Q8XYP6|CLPX_RALSO | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Ralstonia solanacearum (strain GMI1000) GN=clpX PE=3 SV=1 | 171 | 456 | 9.0E-47 |
| sp|Q21Y66|CLPX_RHOFT | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=clpX PE=3 SV=1 | 177 | 443 | 9.0E-47 |
| sp|B0JL96|CLPX_MICAN | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Microcystis aeruginosa (strain NIES-843) GN=clpX PE=3 SV=1 | 175 | 444 | 9.0E-47 |
| sp|Q12BY1|CLPX_POLSJ | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=clpX PE=3 SV=1 | 177 | 443 | 1.0E-46 |
| sp|Q13Z14|CLPX_BURXL | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Burkholderia xenovorans (strain LB400) GN=clpX PE=3 SV=1 | 171 | 456 | 1.0E-46 |
| sp|Q87YR7|CLPX_PSESM | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=clpX PE=3 SV=1 | 181 | 459 | 1.0E-46 |
| sp|Q5R7N3|CLPX_PONAB | ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial OS=Pongo abelii GN=CLPX PE=2 SV=1 | 388 | 481 | 9.0E-08 |
| sp|O76031|CLPX_HUMAN | ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial OS=Homo sapiens GN=CLPX PE=1 SV=2 | 388 | 481 | 9.0E-08 |
| sp|Q5U2U0|CLPX_RAT | ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial OS=Rattus norvegicus GN=Clpx PE=2 SV=1 | 388 | 462 | 9.0E-08 |
| sp|Q9JHS4|CLPX_MOUSE | ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial OS=Mus musculus GN=Clpx PE=1 SV=2 | 388 | 462 | 1.0E-07 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0016887 | ATP hydrolysis activity | Yes |
| GO:0005524 | ATP binding | Yes |
| GO:0043168 | anion binding | No |
| GO:0016818 | hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides | No |
| GO:0016817 | hydrolase activity, acting on acid anhydrides | No |
| GO:0043167 | ion binding | No |
| GO:0003674 | molecular_function | No |
| GO:0032555 | purine ribonucleotide binding | No |
| GO:0005488 | binding | No |
| GO:0016787 | hydrolase activity | No |
| GO:0030554 | adenyl nucleotide binding | No |
| GO:0017076 | purine nucleotide binding | No |
| GO:1901363 | heterocyclic compound binding | No |
| GO:0016462 | pyrophosphatase activity | No |
| GO:0032553 | ribonucleotide binding | No |
| GO:0000166 | nucleotide binding | No |
| GO:0097367 | carbohydrate derivative binding | No |
| GO:0097159 | organic cyclic compound binding | No |
| GO:0036094 | small molecule binding | No |
| GO:0032559 | adenyl ribonucleotide binding | No |
| GO:0017111 | nucleoside-triphosphatase activity | No |
| GO:0003824 | catalytic activity | No |
| GO:0035639 | purine ribonucleoside triphosphate binding | No |
| GO:1901265 | nucleoside phosphate binding | No |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 17 | 0.45 |
Expression values
| Label | Description | Expression (RPKM) | Confidence interval (low) | Confidence interval (high) |
|---|---|---|---|---|
| SC16a | Pure fungal culture | 106.80 | 57.03 | 156.57 |
| CcL | In ants, during behavior modification | 74.92 | 40.74 | 109.10 |
| CcD | In ants, recently dead | 57.35 | 31.33 | 83.38 |
Differential expression
| Label1 | Label2 | Q-value | Significant difference |
|---|---|---|---|
| SC16a | CcL | 0.132330 | no |
| SC16a | CcD | 0.005332 | yes |
| CcL | CcD | 0.254779 | no |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >Ophio5|8211 MFGWSGPLCRQAPRRACRPWRRNRYRPTSPSQLFATSRRTPDFNAGFTGSYDPTAEASRGPMFSKTKFGVPLFYP RDLKKRVDEYVVGQDRAKKTICSTLFNHYQNLRRRHQQYHEDKNVQERLLRQRSARDKEMHQKRRDAQSVEDEFP GHSETVRPSYEVEDFNDSSLDHLYTPEDTSKPEHVKIDKSNLLLIGPTGVGKTYILETLSKKIQVPFSISDCNSL TQAGYIGQDVETCIERLLIEANYDIKATERGIVVLDEFDKLARRESPTGRDVGGEGVQQALLKLVEGTKVNINVK DSRSSRSAPPAASNFSSSSPSTSAPQAAPPVSKVDQYTIDTTNILFIFCGAFVGLDKAVVQRVAKPSLGFGDLWL HTGTHWSFTQHFLVAQYKALFETYPSRLYFTDKALHAIAERAVATDTGARGLKMEMERVLAEPMFDAPTPFVLIT ESCVKGAEKASYWGKDGRFELDRRLEEEEIPDPGPVPQMTFERLREAGQSGG |
| Coding | >Ophio5|8211 ATGTTCGGCTGGTCAGGGCCCCTGTGTCGTCAAGCTCCGCGGCGAGCGTGTAGACCTTGGCGCCGTAACCGCTAC CGACCTACGTCTCCGTCCCAGCTATTCGCCACGTCTCGGCGGACGCCGGATTTCAACGCTGGATTCACGGGTAGC TACGACCCCACGGCGGAAGCGTCTCGTGGGCCGATGTTCAGCAAGACGAAATTCGGAGTTCCTCTGTTTTATCCC CGAGACCTAAAGAAAAGAGTCGACGAATATGTAGTTGGACAGGATCGAGCGAAGAAGACAATATGCTCGACCTTG TTCAATCACTATCAAAACCTGCGTCGGAGACATCAGCAATATCATGAGGACAAAAATGTGCAAGAGAGGCTCCTT CGACAAAGGTCTGCGCGAGACAAGGAGATGCACCAGAAACGTCGCGACGCACAATCTGTCGAAGACGAGTTTCCG GGTCACTCCGAGACTGTGCGGCCGTCGTACGAAGTGGAAGACTTTAATGACAGCTCCCTTGATCATCTGTATACG CCCGAGGACACGTCAAAGCCCGAACACGTCAAGATTGACAAGAGTAACCTACTGTTGATCGGTCCTACTGGTGTC GGAAAGACCTATATACTGGAAACTCTGAGCAAGAAAATTCAAGTCCCATTCTCGATAAGCGACTGTAATTCCTTG ACCCAGGCCGGGTATATCGGCCAGGATGTCGAAACTTGCATCGAGCGGCTGCTCATAGAGGCCAATTATGACATC AAGGCGACGGAACGCGGAATCGTAGTATTGGACGAGTTTGACAAGCTGGCTCGGAGAGAGTCGCCCACCGGTCGA GATGTTGGCGGGGAGGGCGTGCAGCAAGCACTGCTGAAATTAGTCGAAGGGACGAAGGTCAACATTAATGTCAAA GACAGCCGATCCTCGCGATCGGCGCCGCCAGCCGCCAGCAACTTCAGCTCCTCCAGCCCCTCAACGTCGGCGCCG CAAGCTGCCCCTCCCGTTAGCAAGGTGGATCAGTACACCATCGATACGACAAACATACTTTTTATTTTTTGCGGC GCCTTCGTTGGCCTCGACAAGGCCGTGGTTCAACGCGTCGCGAAGCCTTCCCTTGGGTTTGGGGACCTTTGGCTT CATACCGGAACTCATTGGTCGTTTACACAACATTTCCTCGTGGCGCAATACAAAGCCCTATTCGAGACGTACCCA TCTCGACTTTACTTCACCGACAAGGCCTTACACGCAATTGCTGAACGTGCCGTTGCGACTGACACGGGGGCGCGA GGATTGAAGATGGAAATGGAGCGTGTCTTGGCCGAGCCCATGTTCGATGCTCCGACGCCGTTTGTCCTTATCACG GAAAGCTGTGTGAAAGGAGCAGAAAAGGCATCATACTGGGGCAAAGACGGGCGTTTCGAACTCGATCGACGTCTC GAAGAAGAGGAGATACCTGATCCTGGCCCCGTACCCCAAATGACGTTTGAGCGGCTACGGGAAGCTGGCCAGAGT GGTGGT |
| Transcript | >Ophio5|8211 ATGTTCGGCTGGTCAGGGCCCCTGTGTCGTCAAGCTCCGCGGCGAGCGTGTAGACCTTGGCGCCGTAACCGCTAC CGACCTACGTCTCCGTCCCAGCTATTCGCCACGTCTCGGCGGACGCCGGATTTCAACGCTGGATTCACGGGTAGC TACGACCCCACGGCGGAAGCGTCTCGTGGGCCGATGTTCAGCAAGACGAAATTCGGAGTTCCTCTGTTTTATCCC CGAGACCTAAAGAAAAGAGTCGACGAATATGTAGTTGGACAGGATCGAGCGAAGAAGACAATATGCTCGACCTTG TTCAATCACTATCAAAACCTGCGTCGGAGACATCAGCAATATCATGAGGACAAAAATGTGCAAGAGAGGCTCCTT CGACAAAGGTCTGCGCGAGACAAGGAGATGCACCAGAAACGTCGCGACGCACAATCTGTCGAAGACGAGTTTCCG GGTCACTCCGAGACTGTGCGGCCGTCGTACGAAGTGGAAGACTTTAATGACAGCTCCCTTGATCATCTGTATACG CCCGAGGACACGTCAAAGCCCGAACACGTCAAGATTGACAAGAGTAACCTACTGTTGATCGGTCCTACTGGTGTC GGAAAGACCTATATACTGGAAACTCTGAGCAAGAAAATTCAAGTCCCATTCTCGATAAGCGACTGTAATTCCTTG ACCCAGGCCGGGTATATCGGCCAGGATGTCGAAACTTGCATCGAGCGGCTGCTCATAGAGGCCAATTATGACATC AAGGCGACGGAACGCGGAATCGTAGTATTGGACGAGTTTGACAAGCTGGCTCGGAGAGAGTCGCCCACCGGTCGA GATGTTGGCGGGGAGGGCGTGCAGCAAGCACTGCTGAAATTAGTCGAAGGGACGAAGGTCAACATTAATGTCAAA GACAGCCGATCCTCGCGATCGGCGCCGCCAGCCGCCAGCAACTTCAGCTCCTCCAGCCCCTCAACGTCGGCGCCG CAAGCTGCCCCTCCCGTTAGCAAGGTGGATCAGTACACCATCGATACGACAAACATACTTTTTATTTTTTGCGGC GCCTTCGTTGGCCTCGACAAGGCCGTGGTTCAACGCGTCGCGAAGCCTTCCCTTGGGTTTGGGGACCTTTGGCTT CATACCGGAACTCATTGGTCGTTTACACAACATTTCCTCGTGGCGCAATACAAAGCCCTATTCGAGACGTACCCA TCTCGACTTTACTTCACCGACAAGGCCTTACACGCAATTGCTGAACGTGCCGTTGCGACTGACACGGGGGCGCGA GGATTGAAGATGGAAATGGAGCGTGTCTTGGCCGAGCCCATGTTCGATGCTCCGACGCCGTTTGTCCTTATCACG GAAAGCTGTGTGAAAGGAGCAGAAAAGGCATCATACTGGGGCAAAGACGGGCGTTTCGAACTCGATCGACGTCTC GAAGAAGAGGAGATACCTGATCCTGGCCCCGTACCCCAAATGACGTTTGAGCGGCTACGGGAAGCTGGCCAGAGT GGTGGTTGA |
| Gene | >Ophio5|8211 ATGTTCGGCTGGTCAGGGCCCCTGTGTCGTCAAGCTCCGCGGCGAGCGTGTAGACCTTGGCGCCGTAACCGCTAC CGACCTACGTCTCCGTCCCAGCTATTCGCCACGTCTCGGCGGACGCCGGATTTCAACGCTGGATTCACGGGTAGC TACGACCCCACGGCGGAAGCGTCTCGTGGGCCGATGTTCAGCAAGACGAAATTCGGAGTTCCTCTGTTTTATCCC CGAGACCTAAAGAAAAGAGTCGACGAATATGTAGTTGGACAGGATCGAGCGAAGAAGACAATATGCTCGACCTTG TTCAATCACTATCAAAACCTGCGTCGGAGACATCAGCAATATCATGAGGACAAAAATGTGCAAGAGAGGCTCCTT CGACAAAGGTCTGCGCGAGACAAGGAGATGCACCAGAAACGTCGCGACGCACAATCTGTCGAAGGTCAGTCAGAG ACGCGGGAACTGCAAATTCTGACTAATCGATCCCAGACGAGTTTCCGGGTCACTCCGAGACTGTGCGGCCGTCGT ACGAAGTGGAAGACTTTAATGACAGCTCCCTTGATCATCTGTATACGCCCGAGGACACGTCAAAGCCCGAACACG TCAAGATTGACAAGAGTAACCTACTGTTGATCGGTCCTACTGGTGTCGGAAAGACCTATATACTGGAGTGAGTAC GGTAACGACTACCCTCCCTTGTTGGGGCTTTGGAGCTGACTTGGGAAAAGAACTCTGAGCAAGAAAATTCAAGTC CCATTCTCGATAAGCGACTGTAATTCCTTGACCCAGGCCGGGTATATCGGCCAGGATGTCGAAACTTGCATCGAG CGGCTGCTCATAGAGGCCAATTATGACATCAAGGCGACGGAACGCGGAATCGTAGTATTGGACGAGTTTGACAAG CTGGCTCGGAGAGAGTCGCCCACCGGTCGAGATGTTGGCGGGGAGGGCGTGCAGCAAGCACTGCTGAAATTAGTC GAAGGGACGAAGGTCAACATTAATGTCAAAGACAGCCGATCCTCGCGATCGGCGCCGCCAGCCGCCAGCAACTTC AGCTCCTCCAGCCCCTCAACGTCGGCGCCGCAAGCTGCCCCTCCCGTTAGCAAGGTGGATCAGTACACCATCGAT ACGACAAACATACTTTTTATTTTTTGCGGCGCCTTCGTTGGCCTCGACAAGGCCGTGGTTCAACGCGTCGCGAAG CCTTCCCTTGGGTTTGGGGGTGACGTGAAGGGGCGATCGTCCATGGCGGGCAGCAAACATTTTCTCCCGCCGGAA TTGTTCAAACATCTAGCTCATCACGACTCCACGCCAGCAGCTTCATTCACTCCCATGGACCTCGCGACGCCTGCT GACCTGCAGACCTTTGGCTTCATACCGGAACTCATTGGTCGTTTACACAACATTTGTGCCCTAAGTCCCCTTTCA AAGGACGACCTACTGCGTATACTGACAGAGCCACGCAACAGCCTCGTGGCGCAATACAAAGCCCTATTCGAGACG TACCCATCTCGACTTTACTTCACCGACAAGGCCTTACACGCAATTGCTGAACGTGCCGTTGCGACTGACACGGGG GCGCGAGGATTGAAGATGGAAATGGAGCGTGTCTTGGCCGAGCCCATGTTCGATGCTCCGACGCCGTTTGTCCTT ATCACGGAAAGCTGTGTGAAAGGAGCAGAAAAGGCATCATACTGGGGCAAAGACGGGCGTTTCGAACTCGATCGA CGTCTCGAAGAAGAGGAGATACCTGATCCTGGCCCCGTACCCCAAATGACGTTTGAGCGGCTACGGGAAGCTGGC CAGAGTGGTGGTTGA |