Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|821
Gene name
Locationscaffold_1231:70..2273
Strand+
Gene length (bp)2203
Transcript length (bp)1926
Coding sequence length (bp)1923
Protein length (aa) 641

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07662 Nucleos_tra2_C Na+ dependent nucleoside transporter C-terminus 7.6E-71 412 624
PF01773 Nucleos_tra2_N Na+ dependent nucleoside transporter N-terminus 2.9E-22 227 297

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UA35|S28A3_EPTST Solute carrier family 28 member 3 OS=Eptatretus stoutii GN=SLC28A3 PE=2 SV=1 220 631 4.0E-80
sp|Q62674|S28A1_RAT Sodium/nucleoside cotransporter 1 OS=Rattus norvegicus GN=Slc28a1 PE=1 SV=1 219 626 1.0E-74
sp|Q62773|S28A2_RAT Sodium/nucleoside cotransporter 2 OS=Rattus norvegicus GN=Slc28a2 PE=1 SV=1 219 626 1.0E-74
sp|Q9ERH8|S28A3_MOUSE Solute carrier family 28 member 3 OS=Mus musculus GN=Slc28a3 PE=2 SV=1 224 631 2.0E-74
sp|Q8VIH3|S28A3_RAT Solute carrier family 28 member 3 OS=Rattus norvegicus GN=Slc28a3 PE=2 SV=1 221 632 8.0E-74
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UA35|S28A3_EPTST Solute carrier family 28 member 3 OS=Eptatretus stoutii GN=SLC28A3 PE=2 SV=1 220 631 4.0E-80
sp|Q62674|S28A1_RAT Sodium/nucleoside cotransporter 1 OS=Rattus norvegicus GN=Slc28a1 PE=1 SV=1 219 626 1.0E-74
sp|Q62773|S28A2_RAT Sodium/nucleoside cotransporter 2 OS=Rattus norvegicus GN=Slc28a2 PE=1 SV=1 219 626 1.0E-74
sp|Q9ERH8|S28A3_MOUSE Solute carrier family 28 member 3 OS=Mus musculus GN=Slc28a3 PE=2 SV=1 224 631 2.0E-74
sp|Q8VIH3|S28A3_RAT Solute carrier family 28 member 3 OS=Rattus norvegicus GN=Slc28a3 PE=2 SV=1 221 632 8.0E-74
sp|O32115|YUTK_BACSU Uncharacterized transporter YutK OS=Bacillus subtilis (strain 168) GN=yutK PE=3 SV=1 226 627 3.0E-73
sp|O43868|S28A2_HUMAN Sodium/nucleoside cotransporter 2 OS=Homo sapiens GN=SLC28A2 PE=2 SV=2 219 626 7.0E-73
sp|O88627|S28A2_MOUSE Sodium/nucleoside cotransporter 2 OS=Mus musculus GN=Slc28a2 PE=1 SV=2 219 626 2.0E-72
sp|O62667|S28A1_PIG Sodium/nucleoside cotransporter 1 OS=Sus scrofa GN=SLC28A1 PE=2 SV=1 219 626 2.0E-72
sp|Q9MZT2|S28A1_RABIT Sodium/nucleoside cotransporter 1 OS=Oryctolagus cuniculus GN=SLC28A1 PE=2 SV=1 219 626 4.0E-72
sp|Q9HAS3|S28A3_HUMAN Solute carrier family 28 member 3 OS=Homo sapiens GN=SLC28A3 PE=1 SV=1 56 631 1.0E-71
sp|O00337|S28A1_HUMAN Sodium/nucleoside cotransporter 1 OS=Homo sapiens GN=SLC28A1 PE=1 SV=2 217 626 8.0E-70
sp|P44742|Y519_HAEIN Uncharacterized transporter HI_0519 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0519 PE=3 SV=1 225 627 1.0E-69
sp|O25792|NUPC_HELPY Nucleoside permease NupC OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=nupC PE=3 SV=1 225 627 7.0E-53
sp|P33021|NUPX_ECOLI Putative nucleoside permease NupX OS=Escherichia coli (strain K12) GN=nupX PE=1 SV=1 225 627 7.0E-47
sp|P33024|PSUT_ECOLI Putative pseudouridine transporter OS=Escherichia coli (strain K12) GN=psuT PE=1 SV=1 225 627 5.0E-42
sp|P0AFF2|NUPC_ECOLI Nucleoside permease NupC OS=Escherichia coli (strain K12) GN=nupC PE=1 SV=1 229 627 3.0E-29
sp|P0AFF3|NUPC_ECOL6 Nucleoside permease NupC OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=nupC PE=3 SV=1 229 627 3.0E-29
sp|P39141|NUPC_BACSU Nucleoside permease NupC OS=Bacillus subtilis (strain 168) GN=nupC PE=2 SV=4 224 626 3.0E-28
sp|P42312|NUPG_BACSU Purine nucleoside transport protein NupG OS=Bacillus subtilis (strain 168) GN=nupG PE=1 SV=2 224 627 7.0E-27
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.45

Transmembrane Domains

Domain # Start End Length
1 117 139 22
2 143 165 22
3 186 208 22
4 223 241 18
5 248 270 22
6 306 328 22
7 341 363 22
8 383 405 22
9 474 496 22
10 506 525 19
11 568 590 22
12 605 627 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|821
MSTTPCLRPYKDIKNQKPRQNIPTGETAANHGPSAGLGSSWPPRSDGDDDDDDDDNNNNKAKKTAHKAPTTDFVD
AEKGEAGQGSTELTSTRRDDDDDDDVAHRPFYARLDPRHRRVLVHLVVFFLFTGWWIASLVLHRRDKSWLVPFLL
WFAITLRLVFYHVSIRHVSGPIRWLWRHSALVIHDAIPARFRTLVGALAAIIVILVGSFVTEESADNTRANRAVS
LFGMAVILLAFYLTSAARRRINWRTVIVGMLTQYLIGLFVLRTTVGYDIFKFIADRAGDLLGFAKDGVGFLTTPD
VARTPWFFFGVVPAIIFFISLVQVLYHIGFLQWFIRKFATFVFWAMGVSGAEAVVAAATPFIGQGESAMLVRPFV
AHMTRAEIHQILTCGFATISGSVLVGYIGLGLNPEALVSSCIMSIPASLAISKLRYPETEETLTAGRVVLPDDDE
NKAENALHAFANGAWLGIKIGGTIIASLLCILAAVGLVNGLLSWWGRYLNINDPQLTLQTVLSYVFYPVAFLLGV
PRNGDLLRVAKLIAEKVVTNEYNAFTKLAHDPDYAHLSARSQLIATYAVCGFGNIGSLGIQIGILGQLAPSRGGD
VSRLAFSALISGVMSTLTSATVAGLVVTTQISNFTRNGAPS
Coding >Ophio5|821
ATGTCCACCACACCGTGCCTTCGGCCATATAAAGATATAAAGAACCAAAAGCCTCGCCAAAACATCCCAACAGGC
GAGACAGCGGCCAATCATGGTCCTTCAGCTGGACTCGGCTCGTCTTGGCCGCCCCGCTCGGACGGCGACGACGAC
GACGACGACGACGACAACAACAACAACAAGGCCAAAAAGACGGCGCACAAGGCGCCCACTACCGATTTTGTCGAT
GCCGAGAAGGGAGAGGCCGGTCAGGGCTCGACGGAACTGACTTCGACTCGCCGTGATGATGACGACGACGACGAC
GTCGCCCATCGGCCCTTTTATGCCCGTCTGGATCCTCGCCATCGTCGCGTGCTCGTCCATCTCGTCGTCTTCTTC
CTCTTCACCGGCTGGTGGATCGCTTCCCTCGTCCTTCACCGTCGCGACAAGAGTTGGCTCGTGCCCTTTCTCCTC
TGGTTCGCCATCACCCTGCGGCTCGTCTTCTACCACGTCTCCATCCGACATGTCTCGGGTCCCATCCGCTGGCTC
TGGCGTCACTCGGCTCTCGTCATCCACGATGCCATACCTGCCCGCTTTCGTACCCTCGTCGGCGCTCTCGCCGCC
ATCATCGTCATCCTCGTCGGCTCCTTCGTGACGGAGGAGAGCGCCGACAACACCAGGGCCAACCGGGCCGTCAGC
CTCTTCGGCATGGCCGTCATCCTCCTCGCCTTTTACCTGACGAGCGCGGCCCGCCGGCGCATCAACTGGAGGACG
GTCATCGTCGGCATGTTGACCCAGTATCTCATCGGCCTCTTCGTCCTGCGCACCACCGTCGGCTATGACATCTTC
AAGTTCATCGCCGATCGCGCCGGCGATCTGCTCGGCTTCGCCAAGGACGGCGTCGGCTTCCTGACCACTCCCGAC
GTCGCTCGCACGCCCTGGTTCTTCTTTGGAGTCGTGCCCGCCATCATCTTCTTCATCTCCCTCGTCCAGGTGCTC
TATCACATCGGCTTCCTGCAGTGGTTCATCCGCAAGTTCGCCACCTTCGTCTTCTGGGCCATGGGCGTCTCGGGC
GCCGAGGCCGTCGTCGCCGCCGCCACGCCTTTCATCGGCCAGGGCGAGTCGGCCATGCTGGTGCGGCCGTTCGTC
GCCCACATGACGAGGGCCGAGATTCATCAGATCCTGACCTGCGGCTTCGCCACCATCTCCGGCTCCGTCCTCGTC
GGCTACATCGGTCTGGGACTCAACCCGGAGGCCCTCGTGTCGTCGTGCATCATGTCCATACCCGCCTCGCTCGCC
ATCTCCAAGCTGCGCTACCCGGAGACGGAGGAGACGTTGACGGCCGGTCGCGTCGTGCTGCCCGACGACGACGAG
AACAAGGCCGAGAATGCGCTTCACGCGTTTGCCAACGGCGCCTGGCTGGGTATCAAGATTGGCGGCACCATCATC
GCCTCGCTGCTGTGCATCCTGGCCGCCGTCGGGCTCGTCAACGGCCTGCTCTCCTGGTGGGGGCGCTATCTGAAC
ATCAACGATCCGCAGTTGACGCTGCAGACGGTGCTGTCGTACGTCTTTTATCCCGTCGCCTTTTTGCTGGGCGTG
CCGCGGAACGGCGACCTGCTGCGGGTGGCCAAGCTCATTGCCGAAAAGGTGGTGACTAACGAATACAACGCCTTC
ACCAAGCTCGCCCACGATCCCGACTACGCCCACCTCTCGGCCCGGTCGCAGCTCATCGCCACCTACGCCGTCTGC
GGCTTCGGCAACATCGGCTCCCTCGGCATCCAGATCGGCATCCTGGGCCAGCTGGCGCCCTCGCGCGGAGGCGAC
GTCTCGAGGCTCGCCTTTTCCGCCCTCATCTCGGGCGTCATGTCGACGCTGACGTCGGCAACCGTCGCCGGCCTC
GTCGTCACCACGCAGATTTCCAACTTTACCCGCAATGGAGCGCCGTCT
Transcript >Ophio5|821
ATGTCCACCACACCGTGCCTTCGGCCATATAAAGATATAAAGAACCAAAAGCCTCGCCAAAACATCCCAACAGGC
GAGACAGCGGCCAATCATGGTCCTTCAGCTGGACTCGGCTCGTCTTGGCCGCCCCGCTCGGACGGCGACGACGAC
GACGACGACGACGACAACAACAACAACAAGGCCAAAAAGACGGCGCACAAGGCGCCCACTACCGATTTTGTCGAT
GCCGAGAAGGGAGAGGCCGGTCAGGGCTCGACGGAACTGACTTCGACTCGCCGTGATGATGACGACGACGACGAC
GTCGCCCATCGGCCCTTTTATGCCCGTCTGGATCCTCGCCATCGTCGCGTGCTCGTCCATCTCGTCGTCTTCTTC
CTCTTCACCGGCTGGTGGATCGCTTCCCTCGTCCTTCACCGTCGCGACAAGAGTTGGCTCGTGCCCTTTCTCCTC
TGGTTCGCCATCACCCTGCGGCTCGTCTTCTACCACGTCTCCATCCGACATGTCTCGGGTCCCATCCGCTGGCTC
TGGCGTCACTCGGCTCTCGTCATCCACGATGCCATACCTGCCCGCTTTCGTACCCTCGTCGGCGCTCTCGCCGCC
ATCATCGTCATCCTCGTCGGCTCCTTCGTGACGGAGGAGAGCGCCGACAACACCAGGGCCAACCGGGCCGTCAGC
CTCTTCGGCATGGCCGTCATCCTCCTCGCCTTTTACCTGACGAGCGCGGCCCGCCGGCGCATCAACTGGAGGACG
GTCATCGTCGGCATGTTGACCCAGTATCTCATCGGCCTCTTCGTCCTGCGCACCACCGTCGGCTATGACATCTTC
AAGTTCATCGCCGATCGCGCCGGCGATCTGCTCGGCTTCGCCAAGGACGGCGTCGGCTTCCTGACCACTCCCGAC
GTCGCTCGCACGCCCTGGTTCTTCTTTGGAGTCGTGCCCGCCATCATCTTCTTCATCTCCCTCGTCCAGGTGCTC
TATCACATCGGCTTCCTGCAGTGGTTCATCCGCAAGTTCGCCACCTTCGTCTTCTGGGCCATGGGCGTCTCGGGC
GCCGAGGCCGTCGTCGCCGCCGCCACGCCTTTCATCGGCCAGGGCGAGTCGGCCATGCTGGTGCGGCCGTTCGTC
GCCCACATGACGAGGGCCGAGATTCATCAGATCCTGACCTGCGGCTTCGCCACCATCTCCGGCTCCGTCCTCGTC
GGCTACATCGGTCTGGGACTCAACCCGGAGGCCCTCGTGTCGTCGTGCATCATGTCCATACCCGCCTCGCTCGCC
ATCTCCAAGCTGCGCTACCCGGAGACGGAGGAGACGTTGACGGCCGGTCGCGTCGTGCTGCCCGACGACGACGAG
AACAAGGCCGAGAATGCGCTTCACGCGTTTGCCAACGGCGCCTGGCTGGGTATCAAGATTGGCGGCACCATCATC
GCCTCGCTGCTGTGCATCCTGGCCGCCGTCGGGCTCGTCAACGGCCTGCTCTCCTGGTGGGGGCGCTATCTGAAC
ATCAACGATCCGCAGTTGACGCTGCAGACGGTGCTGTCGTACGTCTTTTATCCCGTCGCCTTTTTGCTGGGCGTG
CCGCGGAACGGCGACCTGCTGCGGGTGGCCAAGCTCATTGCCGAAAAGGTGGTGACTAACGAATACAACGCCTTC
ACCAAGCTCGCCCACGATCCCGACTACGCCCACCTCTCGGCCCGGTCGCAGCTCATCGCCACCTACGCCGTCTGC
GGCTTCGGCAACATCGGCTCCCTCGGCATCCAGATCGGCATCCTGGGCCAGCTGGCGCCCTCGCGCGGAGGCGAC
GTCTCGAGGCTCGCCTTTTCCGCCCTCATCTCGGGCGTCATGTCGACGCTGACGTCGGCAACCGTCGCCGGCCTC
GTCGTCACCACGCAGATTTCCAACTTTACCCGCAATGGAGCGCCGTCTTAA
Gene >Ophio5|821
ATGTCCACCACACCGTGCCTTCGGCCGTAGGAACGCGCCCTTCCAAGGAGAATTGTTTTTTTTTTGTTTTCCACA
GGCGCCGCCGAGATCAAAGACGACGACAGAATATACATATATCTTGATCTATATCTTTATATATATATATATCTA
TATTTATATATATACACAAAGATATAAAGATATAAAGAACCAAAAGCCTCGCCAAAACATCCCAACAGGCGAGAC
AGCGGCCAATCATGGTCCTTCAGCTGGACTCGGCTCGTCTTGGCCGCCCCGCTCGGACGGCGACGACGACGACGA
CGACGACGACAACAACAACAACAAGGCCAAAAAGACGGCGCACAAGGCGCCCACTACCGATTTTGTCGATGCCGA
GAAGGGAGAGGCCGGTCAGGGCTCGACGGAACTGACTTCGACTCGCCGTGATGATGACGACGACGACGACGTCGC
CCATCGGCCCTTTTATGCCCGTCTGGATCCTCGCCATCGTCGCGTGCTCGTCCATCTCGTCGTCTTCTTCCTCTT
CACCGGCTGGTGGATCGCTTCCCTCGTCCTTCACCGTCGCGACAAGAGTTGGCTCGTGCCCTTTCTCCTCTGGTT
CGCCATCACCCTGCGGCTCGTCTTCTACCACGTCTCCATCCGACATGTCTCGGGTCCCATCCGCTGGCTCTGGCG
TCACTCGGCTCTCGTCATCCACGATGCCATACCTGCCCGCTTTCGTACCCTCGTCGGCGCTCTCGCCGCCATCAT
CGTCATCCTCGTCGGCTCCTTCGTGACGGAGGAGAGCGCCGACAACACCAGGGCCAACCGGGCCGTCAGCCTCTT
CGGCATGGCCGTCATCCTCCTCGCCTTTTACCTGACGAGCGCGGCCCGCCGGCGCATCAACTGGAGGACGGTCAT
CGTCGGCATGTTGACCCAGTATCTCATCGGCCTCTTCGTCCTGCGCACCACCGTCGGCTATGACATCTTCAAGTT
CATCGCCGATCGCGCCGGCGATCTGCTCGGCTTCGCCAAGGACGGCGTCGGCTTCCTGACCACTCCCGACGTCGC
TCGCACGCCCTGGTTCTTCTTTGGAGTCGTGCCCGCCATCATCTTCTTCATCTCCCTCGTCCAGGTGCTCTATCA
CATCGGCTTCCTGCAGTGGTTCATCCGCAAGTTCGCCACCTTCGTCTTCTGGGCCATGGGCGTCTCGGGCGCCGA
GGCCGTCGTCGCCGCCGCCACGCCTTTCATCGGCCAGGGCGAGTCGGCCATGCTGGTGCGGCCGTTCGTCGCCCA
CATGACGAGGGCCGAGATTCATCAGATCCTGACCTGCGGCTTCGCCACCATCTCCGGCTCCGTCCTCGTCGGCTA
CATCGGTCTGGGACTCAACCCGGAGGCCCTCGTGTCGTCGTGCATCATGTCCATACCCGCCTCGCTCGCCATCTC
CAAGCTGCGCTACCCGGAGACGGAGGAGACGTTGACGGCCGGTCGCGTCGTGCTGCCCGACGACGACGAGAACAA
GGCCGAGAATGCGCTTCACGCGTTTGCCAACGGCGCCTGGCTGGGTATCAAGATTGGCGGCACCATCATCGCCTC
GCTGCTGTGCATCCTGGCCGCCGTCGGGCTCGTCAACGGCCTGCTCTCCTGGTGGGGGCGCTATCTGAACATCAA
CGATCCGCAGTTGACGCTGCAGACGGTGCTGTCGTACGTCTTTTATCCCGTCGCCTTTTTGCTGGGCGTGCCGCG
GAACGGCGACCTGCTGCGGGTGGCCAAGCTCATTGCCGAAAAGGTGGTGACTGTGAGTCTCTTGTGTCTCTCTCT
CCCTCTCTTTCCTCTCTCTCTCTTTGCTCTCCCTCTCTTTTCTCTCCCTCTCCCTCTCCCTCTCCCTCTTTCTCT
CCTTCTCAGAGACACGCTGACGCGACGCCCGCAGAACGAATACAACGCCTTCACCAAGCTCGCCCACGATCCCGA
CTACGCCCACCTCTCGGCCCGGTCGCAGCTCATCGCCACCTACGCCGTCTGCGGCTTCGGCAACATCGGCTCCCT
CGGCATCCAGATCGGCATCCTGGGCCAGCTGGCGCCCTCGCGCGGAGGCGACGTCTCGAGGCTCGCCTTTTCCGC
CCTCATCTCGGGCGTCATGTCGACGCTGACGTCGGCAACCGTCGCCGGCCTCGTCGTCACCACGCAGATTTCCAA
CTTTACCCGCAATGGAGCGCCGTCTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail