Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8195
Gene name
Locationscaffold_880:2280..2877
Strand-
Gene length (bp)597
Transcript length (bp)597
Coding sequence length (bp)594
Protein length (aa) 198

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus 0.4047 0.6963 0.1175 0.0486 0.297 0.0353 0.1289 0.0994 0.1015 0.0174

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5905
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4861
Ophiocordyceps australis map64 (Brazil) OphauB2|5291
Ophiocordyceps camponoti-floridani Ophcf2|02068
Ophiocordyceps camponoti-rufipedis Ophun1|1038
Ophiocordyceps kimflemingae Ophio5|8195 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8195
MPSSFAPRFDPWNSSSTGHQRAPDGGRHRRPRRTQDDRVATQLRDAAAAPPATTRNDNKNKKKDIFAGVVVYIDG
STAPLVSDHRLRGLLVAHGARLATRLARRLVTHVVLASAAATTTTATTATTATTATTTTATATGEERRTPGSRAP
TALSASKLETEIRRRRVAGVRYVDARWYLSLPSLSPPPFLHPQLSVTI
Coding >Ophio5|8195
ATGCCCTCGTCTTTCGCCCCCCGCTTCGACCCCTGGAACTCGTCATCAACAGGCCACCAGCGCGCGCCCGACGGT
GGCCGCCACCGCCGCCCACGCCGGACGCAAGATGACCGAGTGGCGACACAACTTCGCGACGCGGCTGCTGCTCCT
CCGGCGACGACGAGGAACGACAACAAGAACAAGAAGAAGGATATCTTCGCCGGCGTCGTCGTCTACATCGATGGT
AGCACCGCGCCTCTCGTGTCGGACCATCGTCTGCGCGGCTTGCTCGTCGCTCATGGAGCGAGATTGGCTACGAGG
TTGGCGAGGAGGCTTGTCACCCACGTCGTTCTCGCCTCCGCTGCTGCTACTACTACTACTGCCACTACTGCTACT
ACTGCTACTACTGCTACTACTACTACTGCTACTGCTACGGGCGAGGAGAGGAGAACACCGGGGTCGAGGGCCCCG
ACAGCTCTGTCTGCTTCCAAGCTCGAAACGGAGATTCGTCGTCGTCGCGTCGCCGGAGTGCGCTACGTTGATGCT
CGCTGGTACCTCTCTCTCCCCTCCCTCTCCCCCCCCCCCTTTCTTCACCCCCAGCTTTCCGTTACCATC
Transcript >Ophio5|8195
ATGCCCTCGTCTTTCGCCCCCCGCTTCGACCCCTGGAACTCGTCATCAACAGGCCACCAGCGCGCGCCCGACGGT
GGCCGCCACCGCCGCCCACGCCGGACGCAAGATGACCGAGTGGCGACACAACTTCGCGACGCGGCTGCTGCTCCT
CCGGCGACGACGAGGAACGACAACAAGAACAAGAAGAAGGATATCTTCGCCGGCGTCGTCGTCTACATCGATGGT
AGCACCGCGCCTCTCGTGTCGGACCATCGTCTGCGCGGCTTGCTCGTCGCTCATGGAGCGAGATTGGCTACGAGG
TTGGCGAGGAGGCTTGTCACCCACGTCGTTCTCGCCTCCGCTGCTGCTACTACTACTACTGCCACTACTGCTACT
ACTGCTACTACTGCTACTACTACTACTGCTACTGCTACGGGCGAGGAGAGGAGAACACCGGGGTCGAGGGCCCCG
ACAGCTCTGTCTGCTTCCAAGCTCGAAACGGAGATTCGTCGTCGTCGCGTCGCCGGAGTGCGCTACGTTGATGCT
CGCTGGTACCTCTCTCTCCCCTCCCTCTCCCCCCCCCCCTTTCTTCACCCCCAGCTTTCCGTTACCATCTGA
Gene >Ophio5|8195
ATGCCCTCGTCTTTCGCCCCCCGCTTCGACCCCTGGAACTCGTCATCAACAGGCCACCAGCGCGCGCCCGACGGT
GGCCGCCACCGCCGCCCACGCCGGACGCAAGATGACCGAGTGGCGACACAACTTCGCGACGCGGCTGCTGCTCCT
CCGGCGACGACGAGGAACGACAACAAGAACAAGAAGAAGGATATCTTCGCCGGCGTCGTCGTCTACATCGATGGT
AGCACCGCGCCTCTCGTGTCGGACCATCGTCTGCGCGGCTTGCTCGTCGCTCATGGAGCGAGATTGGCTACGAGG
TTGGCGAGGAGGCTTGTCACCCACGTCGTTCTCGCCTCCGCTGCTGCTACTACTACTACTGCCACTACTGCTACT
ACTGCTACTACTGCTACTACTACTACTGCTACTGCTACGGGCGAGGAGAGGAGAACACCGGGGTCGAGGGCCCCG
ACAGCTCTGTCTGCTTCCAAGCTCGAAACGGAGATTCGTCGTCGTCGCGTCGCCGGAGTGCGCTACGTTGATGCT
CGCTGGTACCTCTCTCTCCCCTCCCTCTCCCCCCCCCCCTTTCTTCACCCCCAGCTTTCCGTTACCATCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail