Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8194
Gene name
Locationscaffold_880:505..1091
Strand+
Gene length (bp)586
Transcript length (bp)471
Coding sequence length (bp)468
Protein length (aa) 156

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q01302|CCG6_NEUCR Clock-controlled protein 6 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ccg-6 PE=2 SV=2 22 156 1.0E-36
sp|Q01589|SED1_YEAST Cell wall protein SED1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SED1 PE=1 SV=1 16 70 2.0E-12
sp|P40092|SPI1_YEAST Uncharacterized cell wall protein SPI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPI1 PE=2 SV=1 28 94 3.0E-11
sp|Q01589|SED1_YEAST Cell wall protein SED1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SED1 PE=1 SV=1 33 69 7.0E-10

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8194
MKSSVAAVLAVAAGASAHYGGNATVVTEVVDVYTTYCPGPTQITHGSKTYTVTEATTLTITDCPCTITKPILTTS
AVVCHTCAGNYNNGTATMINPTATPPTATVIPPGNTVTPPAGSNPGATQAPTAVPTAAASKVAVFSGAGLAGVVG
LAAFLL
Coding >Ophio5|8194
ATGAAGTCTTCCGTCGCCGCCGTCCTCGCTGTCGCCGCTGGTGCTTCAGCCCACTATGGTGGTAACGCCACCGTG
GTCACCGAGGTCGTCGATGTCTATACCACCTACTGCCCGGGCCCGACTCAGATCACCCACGGCAGCAAGACGTAT
ACTGTCACTGAGGCCACGACGCTCACCATCACCGACTGCCCCTGCACCATCACCAAGCCCATCCTGACGACGTCT
GCCGTCGTGTGCCACACCTGCGCTGGCAACTACAACAATGGCACCGCCACCATGATCAACCCCACGGCCACTCCC
CCGACGGCCACCGTCATTCCTCCCGGCAATACCGTCACGCCCCCTGCCGGCTCCAACCCCGGCGCCACGCAGGCT
CCCACGGCTGTCCCCACGGCCGCCGCCTCCAAGGTGGCCGTCTTCTCCGGCGCCGGCCTGGCCGGTGTCGTCGGT
CTGGCTGCCTTCCTGCTG
Transcript >Ophio5|8194
ATGAAGTCTTCCGTCGCCGCCGTCCTCGCTGTCGCCGCTGGTGCTTCAGCCCACTATGGTGGTAACGCCACCGTG
GTCACCGAGGTCGTCGATGTCTATACCACCTACTGCCCGGGCCCGACTCAGATCACCCACGGCAGCAAGACGTAT
ACTGTCACTGAGGCCACGACGCTCACCATCACCGACTGCCCCTGCACCATCACCAAGCCCATCCTGACGACGTCT
GCCGTCGTGTGCCACACCTGCGCTGGCAACTACAACAATGGCACCGCCACCATGATCAACCCCACGGCCACTCCC
CCGACGGCCACCGTCATTCCTCCCGGCAATACCGTCACGCCCCCTGCCGGCTCCAACCCCGGCGCCACGCAGGCT
CCCACGGCTGTCCCCACGGCCGCCGCCTCCAAGGTGGCCGTCTTCTCCGGCGCCGGCCTGGCCGGTGTCGTCGGT
CTGGCTGCCTTCCTGCTGTAA
Gene >Ophio5|8194
ATGAAGTCTTCCGTCGCCGCCGTCCTCGCTGTCGCCGCTGGTGCTTCAGCCCACTATGGTGGTAACGCCACCGTG
GTCACCGAGGTCGTCGATGTCTATACCACCTACTGCCCGGGCCCGACTCAGATCACCCACGGCAGCAAGACGTAT
ACTGTCACTGAGGTGGGTGCTTTGTTTTGTTCTGACTCGAGTTCAGTTGCTGACGCGCCAGTTGTATAGGCCACG
ACGCTCACCATCACCGACTGCCCCTGCACCATCACCAAGCCCATCCTGACGACGTCTGCCGTCGTGTGCCACACC
TGGTCCGTTTTCCTTTCTTTTCTGGCTCCGTGGCATGGCTCTCGTCTGACCCTCCTCCAGCGCTGGCAACTACAA
CAATGGCACCGCCACCATGATCAACCCCACGGCCACTCCCCCGACGGCCACCGTCATTCCTCCCGGCAATACCGT
CACGCCCCCTGCCGGCTCCAACCCCGGCGCCACGCAGGCTCCCACGGCTGTCCCCACGGCCGCCGCCTCCAAGGT
GGCCGTCTTCTCCGGCGCCGGCCTGGCCGGTGTCGTCGGTCTGGCTGCCTTCCTGCTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail