Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8184
Gene name
Locationscaffold_88:17325..18687
Strand-
Gene length (bp)1362
Transcript length (bp)1362
Coding sequence length (bp)1359
Protein length (aa) 453

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03781 FGE-sulfatase Sulfatase-modifying factor enzyme 1 1.9E-46 174 451

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8NBK3|SUMF1_HUMAN Sulfatase-modifying factor 1 OS=Homo sapiens GN=SUMF1 PE=1 SV=3 177 392 4.0E-19
sp|Q0P5L5|SUMF1_BOVIN Sulfatase-modifying factor 1 OS=Bos taurus GN=SUMF1 PE=2 SV=1 177 392 7.0E-19
sp|Q8R0F3|SUMF1_MOUSE Sulfatase-modifying factor 1 OS=Mus musculus GN=Sumf1 PE=1 SV=2 177 392 8.0E-19
sp|Q8BPG6|SUMF2_MOUSE Sulfatase-modifying factor 2 OS=Mus musculus GN=Sumf2 PE=1 SV=2 173 420 8.0E-16
sp|Q58CP2|SUMF2_BOVIN Sulfatase-modifying factor 2 OS=Bos taurus GN=SUMF2 PE=2 SV=1 176 420 1.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8NBK3|SUMF1_HUMAN Sulfatase-modifying factor 1 OS=Homo sapiens GN=SUMF1 PE=1 SV=3 177 392 4.0E-19
sp|Q0P5L5|SUMF1_BOVIN Sulfatase-modifying factor 1 OS=Bos taurus GN=SUMF1 PE=2 SV=1 177 392 7.0E-19
sp|Q8R0F3|SUMF1_MOUSE Sulfatase-modifying factor 1 OS=Mus musculus GN=Sumf1 PE=1 SV=2 177 392 8.0E-19
sp|Q8BPG6|SUMF2_MOUSE Sulfatase-modifying factor 2 OS=Mus musculus GN=Sumf2 PE=1 SV=2 173 420 8.0E-16
sp|Q58CP2|SUMF2_BOVIN Sulfatase-modifying factor 2 OS=Bos taurus GN=SUMF2 PE=2 SV=1 176 420 1.0E-12
sp|Q5RCR5|SUMF2_PONAB Sulfatase-modifying factor 2 OS=Pongo abelii GN=SUMF2 PE=2 SV=1 173 420 2.0E-10
sp|Q8NBJ7|SUMF2_HUMAN Sulfatase-modifying factor 2 OS=Homo sapiens GN=SUMF2 PE=1 SV=2 173 420 3.0E-10
sp|Q822R1|PKN1_CHLCV Serine/threonine-protein kinase pkn1 OS=Chlamydophila caviae (strain GPIC) GN=pkn1 PE=3 SV=1 271 433 4.0E-10
sp|Q7AJA5|PKN1_CHLPN Serine/threonine-protein kinase pkn1 OS=Chlamydia pneumoniae GN=pkn1 PE=3 SV=1 271 433 7.0E-10
sp|O84147|PKN1_CHLTR Serine/threonine-protein kinase pkn1 OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=pkn1 PE=1 SV=1 271 433 7.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8184
MLMFSQVSMPALLIALGGVASMTVPDVSSTGQLQMKLSELSESLRWSGTTHSTYAPIEPAARAAHSILVSLAATD
AKAVPRAQEFIDTLSRLVAESHHLAELSRPRTYKAGFLDSATFLTGSVNEWHHTIRLMMANLTQPSSYRPPQPRS
KMAGDSKVDQSTKPGTEFRDWDQGPTMVVIPTGSYTAGSSDAELKEWRVPADRQPYEQPQRRVHIAKPLAFSRTE
VELSQFEAFVQETKYQPRGGARWWNPDDPTVMVFNPHLDFRNPGFPQQANYPVVAITRQDAWAYTNWLSVVTGHK
YRLPTEEEWEWAARGGTNTTFFWGNDRHVELANLYANTYDQTSQKANRFQWPAANVTDGYAYTAPVASFRPNGFG
LYDMTANAREFMADSWVPFLGSVAANDGSVHTGPAPFPVLRGAAWDYTPRNLRINYRNAYFSSEVATNMFGIRLV
REL
Coding >Ophio5|8184
ATGTTGATGTTTTCTCAAGTCTCGATGCCAGCGCTGCTTATAGCGCTCGGGGGTGTCGCTTCCATGACAGTTCCG
GACGTCTCAAGCACGGGACAGTTACAGATGAAGCTATCCGAGCTCTCCGAGTCGCTGCGTTGGTCTGGCACGACA
CACTCGACGTATGCGCCGATTGAGCCTGCAGCGCGTGCGGCTCACTCGATACTCGTCTCGCTGGCGGCAACAGAC
GCCAAAGCGGTGCCACGCGCCCAAGAGTTCATCGACACGCTGAGCAGGCTCGTGGCGGAGAGTCACCATCTGGCC
GAGTTGTCTCGGCCGAGGACGTACAAGGCCGGCTTCCTCGACTCGGCCACGTTCCTGACGGGCAGCGTCAACGAG
TGGCACCACACCATCAGACTCATGATGGCCAACTTGACACAGCCGTCCAGCTATCGCCCGCCGCAGCCTCGCAGC
AAGATGGCAGGCGATAGTAAAGTCGACCAGTCGACCAAGCCCGGAACTGAATTCCGTGACTGGGACCAAGGCCCG
ACCATGGTGGTGATCCCTACGGGGTCGTACACGGCAGGCTCGTCCGACGCCGAACTCAAGGAGTGGAGGGTTCCG
GCCGATAGACAGCCTTATGAGCAGCCTCAGCGACGTGTACACATCGCCAAGCCGCTGGCCTTTAGCCGGACCGAG
GTCGAGCTCTCGCAGTTCGAAGCCTTTGTGCAGGAAACAAAGTATCAGCCCCGAGGCGGTGCCCGATGGTGGAAT
CCAGATGATCCGACTGTCATGGTCTTCAACCCGCATCTCGACTTCCGCAACCCCGGCTTCCCACAGCAGGCCAAC
TATCCCGTCGTGGCCATCACCCGTCAGGATGCCTGGGCCTACACCAACTGGCTCTCCGTCGTCACCGGCCACAAG
TATCGGCTTCCCACCGAGGAAGAGTGGGAGTGGGCGGCTCGCGGGGGCACTAACACGACCTTCTTCTGGGGCAAC
GACCGTCACGTCGAGCTGGCAAACCTCTACGCCAACACGTACGACCAGACATCGCAAAAGGCCAACCGATTCCAA
TGGCCAGCCGCAAACGTCACCGACGGTTACGCTTATACGGCGCCCGTGGCCTCCTTCCGCCCCAACGGCTTCGGT
CTCTACGACATGACGGCCAATGCGCGCGAGTTCATGGCTGACTCGTGGGTTCCCTTCCTCGGCTCCGTAGCAGCC
AACGACGGCTCGGTTCATACAGGGCCCGCGCCGTTTCCCGTCCTTCGAGGAGCGGCTTGGGATTACACGCCAAGG
AACCTACGCATCAACTATCGCAACGCCTACTTTTCCAGTGAGGTGGCGACTAACATGTTCGGCATCCGCTTGGTG
CGCGAGTTG
Transcript >Ophio5|8184
ATGTTGATGTTTTCTCAAGTCTCGATGCCAGCGCTGCTTATAGCGCTCGGGGGTGTCGCTTCCATGACAGTTCCG
GACGTCTCAAGCACGGGACAGTTACAGATGAAGCTATCCGAGCTCTCCGAGTCGCTGCGTTGGTCTGGCACGACA
CACTCGACGTATGCGCCGATTGAGCCTGCAGCGCGTGCGGCTCACTCGATACTCGTCTCGCTGGCGGCAACAGAC
GCCAAAGCGGTGCCACGCGCCCAAGAGTTCATCGACACGCTGAGCAGGCTCGTGGCGGAGAGTCACCATCTGGCC
GAGTTGTCTCGGCCGAGGACGTACAAGGCCGGCTTCCTCGACTCGGCCACGTTCCTGACGGGCAGCGTCAACGAG
TGGCACCACACCATCAGACTCATGATGGCCAACTTGACACAGCCGTCCAGCTATCGCCCGCCGCAGCCTCGCAGC
AAGATGGCAGGCGATAGTAAAGTCGACCAGTCGACCAAGCCCGGAACTGAATTCCGTGACTGGGACCAAGGCCCG
ACCATGGTGGTGATCCCTACGGGGTCGTACACGGCAGGCTCGTCCGACGCCGAACTCAAGGAGTGGAGGGTTCCG
GCCGATAGACAGCCTTATGAGCAGCCTCAGCGACGTGTACACATCGCCAAGCCGCTGGCCTTTAGCCGGACCGAG
GTCGAGCTCTCGCAGTTCGAAGCCTTTGTGCAGGAAACAAAGTATCAGCCCCGAGGCGGTGCCCGATGGTGGAAT
CCAGATGATCCGACTGTCATGGTCTTCAACCCGCATCTCGACTTCCGCAACCCCGGCTTCCCACAGCAGGCCAAC
TATCCCGTCGTGGCCATCACCCGTCAGGATGCCTGGGCCTACACCAACTGGCTCTCCGTCGTCACCGGCCACAAG
TATCGGCTTCCCACCGAGGAAGAGTGGGAGTGGGCGGCTCGCGGGGGCACTAACACGACCTTCTTCTGGGGCAAC
GACCGTCACGTCGAGCTGGCAAACCTCTACGCCAACACGTACGACCAGACATCGCAAAAGGCCAACCGATTCCAA
TGGCCAGCCGCAAACGTCACCGACGGTTACGCTTATACGGCGCCCGTGGCCTCCTTCCGCCCCAACGGCTTCGGT
CTCTACGACATGACGGCCAATGCGCGCGAGTTCATGGCTGACTCGTGGGTTCCCTTCCTCGGCTCCGTAGCAGCC
AACGACGGCTCGGTTCATACAGGGCCCGCGCCGTTTCCCGTCCTTCGAGGAGCGGCTTGGGATTACACGCCAAGG
AACCTACGCATCAACTATCGCAACGCCTACTTTTCCAGTGAGGTGGCGACTAACATGTTCGGCATCCGCTTGGTG
CGCGAGTTGTGA
Gene >Ophio5|8184
ATGTTGATGTTTTCTCAAGTCTCGATGCCAGCGCTGCTTATAGCGCTCGGGGGTGTCGCTTCCATGACAGTTCCG
GACGTCTCAAGCACGGGACAGTTACAGATGAAGCTATCCGAGCTCTCCGAGTCGCTGCGTTGGTCTGGCACGACA
CACTCGACGTATGCGCCGATTGAGCCTGCAGCGCGTGCGGCTCACTCGATACTCGTCTCGCTGGCGGCAACAGAC
GCCAAAGCGGTGCCACGCGCCCAAGAGTTCATCGACACGCTGAGCAGGCTCGTGGCGGAGAGTCACCATCTGGCC
GAGTTGTCTCGGCCGAGGACGTACAAGGCCGGCTTCCTCGACTCGGCCACGTTCCTGACGGGCAGCGTCAACGAG
TGGCACCACACCATCAGACTCATGATGGCCAACTTGACACAGCCGTCCAGCTATCGCCCGCCGCAGCCTCGCAGC
AAGATGGCAGGCGATAGTAAAGTCGACCAGTCGACCAAGCCCGGAACTGAATTCCGTGACTGGGACCAAGGCCCG
ACCATGGTGGTGATCCCTACGGGGTCGTACACGGCAGGCTCGTCCGACGCCGAACTCAAGGAGTGGAGGGTTCCG
GCCGATAGACAGCCTTATGAGCAGCCTCAGCGACGTGTACACATCGCCAAGCCGCTGGCCTTTAGCCGGACCGAG
GTCGAGCTCTCGCAGTTCGAAGCCTTTGTGCAGGAAACAAAGTATCAGCCCCGAGGCGGTGCCCGATGGTGGAAT
CCAGATGATCCGACTGTCATGGTCTTCAACCCGCATCTCGACTTCCGCAACCCCGGCTTCCCACAGCAGGCCAAC
TATCCCGTCGTGGCCATCACCCGTCAGGATGCCTGGGCCTACACCAACTGGCTCTCCGTCGTCACCGGCCACAAG
TATCGGCTTCCCACCGAGGAAGAGTGGGAGTGGGCGGCTCGCGGGGGCACTAACACGACCTTCTTCTGGGGCAAC
GACCGTCACGTCGAGCTGGCAAACCTCTACGCCAACACGTACGACCAGACATCGCAAAAGGCCAACCGATTCCAA
TGGCCAGCCGCAAACGTCACCGACGGTTACGCTTATACGGCGCCCGTGGCCTCCTTCCGCCCCAACGGCTTCGGT
CTCTACGACATGACGGCCAATGCGCGCGAGTTCATGGCTGACTCGTGGGTTCCCTTCCTCGGCTCCGTAGCAGCC
AACGACGGCTCGGTTCATACAGGGCCCGCGCCGTTTCCCGTCCTTCGAGGAGCGGCTTGGGATTACACGCCAAGG
AACCTACGCATCAACTATCGCAACGCCTACTTTTCCAGTGAGGTGGCGACTAACATGTTCGGCATCCGCTTGGTG
CGCGAGTTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail