Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8182
Gene name
Locationscaffold_88:14478..15192
Strand-
Gene length (bp)714
Transcript length (bp)714
Coding sequence length (bp)711
Protein length (aa) 237

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 20 216 3.0E-34
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 20 221 6.0E-34
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 14 216 5.0E-33
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 14 216 4.0E-32
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 20 221 1.0E-31
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 20 216 3.0E-34
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 20 221 6.0E-34
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 14 216 5.0E-33
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 14 216 4.0E-32
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 20 221 1.0E-31
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 14 221 2.0E-30
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 14 216 4.0E-30
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 13 215 1.0E-28
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 20 221 2.0E-26
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 25 215 2.0E-25
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 19 216 3.0E-25
sp|Q10487|MFS1_SCHPO Transporter mfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs1 PE=3 SV=1 21 216 2.0E-24
sp|O43081|YHS6_SCHPO Uncharacterized MFS-type transporter C947.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.06c PE=3 SV=1 22 219 4.0E-24
sp|Q12256|TPO4_YEAST Polyamine transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO4 PE=1 SV=1 20 216 4.0E-21
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 21 216 5.0E-21
sp|Q06451|TPO3_YEAST Polyamine transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO3 PE=1 SV=1 20 214 2.0E-18
sp|P53283|TPO2_YEAST Polyamine transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO2 PE=1 SV=1 20 214 2.0E-18
sp|P38124|FLR1_YEAST Fluconazole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLR1 PE=1 SV=1 20 220 5.0E-18
sp|P32071|CYHR_CANMA Cycloheximide resistance protein OS=Candida maltosa GN=CYHR PE=3 SV=1 20 216 4.0E-14
sp|P28873|BMRP_CANAX Benomyl/methotrexate resistance protein OS=Candida albicans GN=MDR1 PE=3 SV=1 20 216 4.0E-14
sp|Q5ABU7|MDR1_CANAL Multidrug resistance protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDR1 PE=1 SV=1 20 216 4.0E-14
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 14 218 6.0E-14
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 9 214 2.0E-13
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 22 213 2.0E-13
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 22 213 1.0E-12
sp|O59833|YCUD_SCHPO Uncharacterized transporter C965.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC965.13 PE=3 SV=1 19 230 4.0E-10
sp|G2TRN8|YI74_SCHPO Putative uncharacterized transporter C977.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC977.04 PE=5 SV=1 83 213 1.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.5

Transmembrane Domains

Domain # Start End Length
1 20 37 17
2 47 69 22
3 90 109 19
4 119 141 22
5 148 170 22
6 185 207 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8182
MASYPVFHRKPTGLTATRNALVYGVLYLCFVAYPVVFSRYRGWGPGLTGLSFLGIGFGIVLAILLEPLIRGFINA
QARDPKTGKPPPEAAALVMVIGSLLTPIGQLGFSWTSLPKSIHWSIPILFGIPFGAGNTLSFVYSSNYLAGAYGV
YAASALASNAVIRSIFGAALPLAGTKMYQSLTPQLAGTLCGVFEVAMIPIPFVFWKYGQRIRDKSKTIRQLREKN
EGRQLVDNGDER
Coding >Ophio5|8182
ATGGCGAGTTACCCAGTATTCCACAGGAAGCCGACCGGGCTAACAGCGACTAGGAACGCACTCGTCTACGGTGTC
CTTTACCTTTGCTTCGTCGCGTACCCGGTTGTCTTCTCGCGCTATCGTGGCTGGGGTCCAGGTCTTACTGGGTTG
TCCTTTCTCGGCATCGGCTTCGGAATCGTGCTTGCCATCCTCTTAGAGCCGCTGATCAGGGGGTTCATCAACGCA
CAAGCCCGAGACCCCAAGACGGGAAAGCCACCGCCGGAAGCCGCTGCACTTGTCATGGTCATCGGGTCCTTGCTC
ACACCCATCGGTCAGTTAGGTTTCTCGTGGACCTCTTTACCCAAATCTATTCATTGGTCTATCCCAATCCTCTTC
GGCATCCCCTTCGGCGCAGGAAATACCCTCAGTTTCGTCTACTCGTCGAATTATCTAGCGGGCGCCTACGGAGTT
TATGCGGCGAGCGCCCTCGCCAGCAATGCTGTCATCCGGAGTATCTTTGGGGCTGCTCTGCCGCTCGCAGGCACG
AAGATGTACCAGTCTCTGACGCCGCAACTCGCGGGCACGTTATGTGGCGTCTTTGAGGTGGCCATGATTCCTATT
CCCTTTGTCTTCTGGAAGTATGGTCAGCGCATTCGAGACAAGAGTAAGACGATTCGCCAGCTTCGCGAGAAGAAC
GAGGGCCGGCAACTCGTCGATAATGGAGACGAGAGG
Transcript >Ophio5|8182
ATGGCGAGTTACCCAGTATTCCACAGGAAGCCGACCGGGCTAACAGCGACTAGGAACGCACTCGTCTACGGTGTC
CTTTACCTTTGCTTCGTCGCGTACCCGGTTGTCTTCTCGCGCTATCGTGGCTGGGGTCCAGGTCTTACTGGGTTG
TCCTTTCTCGGCATCGGCTTCGGAATCGTGCTTGCCATCCTCTTAGAGCCGCTGATCAGGGGGTTCATCAACGCA
CAAGCCCGAGACCCCAAGACGGGAAAGCCACCGCCGGAAGCCGCTGCACTTGTCATGGTCATCGGGTCCTTGCTC
ACACCCATCGGTCAGTTAGGTTTCTCGTGGACCTCTTTACCCAAATCTATTCATTGGTCTATCCCAATCCTCTTC
GGCATCCCCTTCGGCGCAGGAAATACCCTCAGTTTCGTCTACTCGTCGAATTATCTAGCGGGCGCCTACGGAGTT
TATGCGGCGAGCGCCCTCGCCAGCAATGCTGTCATCCGGAGTATCTTTGGGGCTGCTCTGCCGCTCGCAGGCACG
AAGATGTACCAGTCTCTGACGCCGCAACTCGCGGGCACGTTATGTGGCGTCTTTGAGGTGGCCATGATTCCTATT
CCCTTTGTCTTCTGGAAGTATGGTCAGCGCATTCGAGACAAGAGTAAGACGATTCGCCAGCTTCGCGAGAAGAAC
GAGGGCCGGCAACTCGTCGATAATGGAGACGAGAGGTAA
Gene >Ophio5|8182
ATGGCGAGTTACCCAGTATTCCACAGGAAGCCGACCGGGCTAACAGCGACTAGGAACGCACTCGTCTACGGTGTC
CTTTACCTTTGCTTCGTCGCGTACCCGGTTGTCTTCTCGCGCTATCGTGGCTGGGGTCCAGGTCTTACTGGGTTG
TCCTTTCTCGGCATCGGCTTCGGAATCGTGCTTGCCATCCTCTTAGAGCCGCTGATCAGGGGGTTCATCAACGCA
CAAGCCCGAGACCCCAAGACGGGAAAGCCACCGCCGGAAGCCGCTGCACTTGTCATGGTCATCGGGTCCTTGCTC
ACACCCATCGGTCAGTTAGGTTTCTCGTGGACCTCTTTACCCAAATCTATTCATTGGTCTATCCCAATCCTCTTC
GGCATCCCCTTCGGCGCAGGAAATACCCTCAGTTTCGTCTACTCGTCGAATTATCTAGCGGGCGCCTACGGAGTT
TATGCGGCGAGCGCCCTCGCCAGCAATGCTGTCATCCGGAGTATCTTTGGGGCTGCTCTGCCGCTCGCAGGCACG
AAGATGTACCAGTCTCTGACGCCGCAACTCGCGGGCACGTTATGTGGCGTCTTTGAGGTGGCCATGATTCCTATT
CCCTTTGTCTTCTGGAAGTATGGTCAGCGCATTCGAGACAAGAGTAAGACGATTCGCCAGCTTCGCGAGAAGAAC
GAGGGCCGGCAACTCGTCGATAATGGAGACGAGAGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail