Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8181
Gene name
Locationscaffold_88:6308..11006
Strand-
Gene length (bp)4698
Transcript length (bp)4563
Coding sequence length (bp)4563
Protein length (aa) 1521

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13646 HEAT_2 HEAT repeats 5.0E-07 1043 1122
PF13646 HEAT_2 HEAT repeats 1.1E-07 1123 1205
PF05729 NACHT NACHT domain 3.3E-12 435 600

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q86W26|NAL10_HUMAN NACHT, LRR and PYD domains-containing protein 10 OS=Homo sapiens GN=NLRP10 PE=1 SV=1 432 654 3.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.5

Transmembrane Domains

Domain # Start End Length
1 2 21 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8181
MASVNIGYLILLAVGTAFFYLRLRRGLPRPPITIPARQESAPSAEPRRGVRLCQVPATNSSEAETDVDIIAIHGL
DTKSPDTWIWKDKKNIIPPVNWLSDSHMLPSRVGPARIFTCDWPADLFEPCGLTPKTNQEFARRLLDGIKRRPPP
ADGRTCEDRPILFIASCLGGIVLMKALVMANNEYSCVRTATRGVVFLATPFGGTSFQGVAKWAEPGLKAWASLRR
QEVSKLLDSVKQSVDIDELVRGFTQLCRDPTGPQVMTFYELGETNIYHKVFPSLPVGSKPLVDKSSATLQIVPNP
LPLDRCHQLMNKFCGDQGDAKDDDYPVVVGKVEEFLQNIRKKDADDWIRDNHYTLERLKIERLSGEPLPMDQCYI
NLAIVKQWEDSMNSSDTSQSSPFSLFARQKVVTPDKTVQIDLAKLFNEREGRNGHQIKPRRILIRGRAGVGKTTL
CKKMVYDFTYGTQTELHRSWNESFDRLLWVPLRHLKGRPTSGYSYEDLFYHEYFWDFDDGRRLAGELWRTLRNDA
SGRTLFILDGLDEVSQDIVGAGNDMSRFFQHLLDQPNVIITSRPNASLPTLRPLDLELETIGFYPDQVTEYINKT
CDSSKAERIKLVLQQHWLIKGLVRIPIQLDALCYAWDEFNTGIVPRTMTDIYKAIEKRLWKKDVVRLGKKHDGEP
ITPYQIGLFDVEDLVDNEISLLEGVAFTGLHNNMIDFTPQNLAIISKQFKDKSILLDKTLPHLSFLRTSDPFSEE
GKRDYHFLHLTYQEYYAARYFVREWISEQPLKCLDLNDRRTYKMLPVEFLHQQKYTARYDVFWRFVTGLLAAEDE
GDARDEGRTLSFLRTIEQGPLDLLGPTHQRLLMRCLSEASANIPVSSKECLERSLKQWLLFECTLTPEDSSWRLL
SSEMEFPDAVLSDTMKEISDGAKIKILRSLHDRLETLPSVNRLVVSWLRDDDISRQFIASVLQVYHYHGAGLSSD
TLTAVVQRLDDDHSGVRTGVIRVLQVQPDLSDEALTAVIQRLGDEDVRGYALAMLADQPNLSDEVLTAVIQRLGD
GNSEVREGALFILKAQNLSDLALTAVIQRLGDDDWRVRQGAMSVLRAQPNLSDEALTAVIQRLGDDNEYTLTAVI
QRLGDDDEDVRHSALAVLVHQPNLSDEALTVVIQRLGDDDWLVRMGAMKVLRRLSSLSDQAFAAVIQRLDDNDEG
MLRTAREFLSQWPTSTDSFLAAVIQRLRDSDGCIREAALHFLRKGPGLPNEFLITVGQMLSNDDSAIRSAAIDFL
SIQANEVPLVISQLMEIWDRGWLTDLNFLYLLEIQPSLSEEILTVVVRMLDDDNKQPYLKVVLNVLQKQPSLSDE
ILTIIVRMLDDDEDSYLRIKALEVLRKQPSLSDEILTVVVRMLDDDKGDRLLLKTVLGLLMHQSELSEEILTAAA
QLLESERAGHLAEAVLRKHERFYSTLLVGSSAGSLLKTLSRLAFGEQVSWYIQNGRSCINMPDGIRTFGIDDEEE
LMNLLNEARLPDAPPVAAGL*
Coding >Ophio5|8181
ATGGCCTCAGTCAACATTGGCTATCTCATTCTTCTGGCTGTGGGAACAGCTTTCTTTTATCTTCGGCTTCGCCGC
GGGCTGCCACGGCCCCCAATCACAATCCCCGCTCGTCAAGAGTCGGCACCATCCGCTGAACCAAGGCGAGGTGTC
CGTCTATGCCAGGTCCCTGCTACGAATAGCTCCGAAGCCGAGACAGATGTCGACATCATCGCCATCCATGGCCTA
GACACGAAGTCGCCAGACACTTGGATCTGGAAGGATAAAAAGAACATAATTCCCCCGGTCAATTGGCTTTCCGAC
TCCCATATGCTCCCGAGCAGAGTCGGACCGGCTCGGATATTCACCTGCGACTGGCCAGCCGACTTATTCGAACCG
TGTGGCCTGACACCGAAAACGAATCAAGAGTTTGCTCGGCGTTTACTCGATGGCATCAAGAGGCGACCGCCACCA
GCCGATGGCCGCACATGTGAAGACCGGCCGATCCTCTTCATTGCGTCTTGCCTCGGGGGTATAGTCTTGATGAAG
GCTCTCGTCATGGCCAATAACGAGTACAGTTGCGTCAGAACCGCCACACGTGGTGTTGTCTTTCTTGCCACTCCA
TTTGGAGGCACTTCGTTCCAGGGAGTGGCCAAGTGGGCAGAGCCGGGCCTCAAGGCCTGGGCTTCTTTAAGACGT
CAAGAAGTGTCGAAGCTGCTCGATAGCGTCAAGCAATCCGTTGATATCGACGAACTTGTCCGAGGCTTCACTCAG
TTATGCCGGGATCCAACCGGGCCCCAAGTCATGACGTTCTATGAACTAGGCGAGACGAACATTTACCACAAGGTC
TTTCCTTCTTTACCAGTTGGATCCAAACCGCTTGTGGATAAGTCTTCAGCGACCCTGCAAATCGTCCCAAATCCT
TTGCCACTCGACAGATGCCACCAGTTGATGAATAAGTTCTGTGGCGACCAGGGCGACGCCAAAGATGACGATTAC
CCTGTTGTGGTTGGAAAAGTTGAGGAGTTTTTGCAAAATATTCGCAAGAAGGACGCGGACGACTGGATCCGGGAT
AACCATTATACCCTGGAGAGGCTCAAGATCGAACGTCTCTCGGGCGAGCCATTGCCGATGGATCAGTGTTACATC
AACCTTGCCATTGTGAAGCAGTGGGAAGACAGCATGAACAGCTCAGATACATCGCAGTCATCCCCGTTTTCACTT
TTTGCCCGTCAAAAAGTTGTTACCCCAGATAAGACGGTTCAGATCGATCTGGCAAAACTCTTCAATGAGCGAGAA
GGGCGCAACGGTCACCAGATAAAACCTAGACGAATATTGATCCGCGGACGCGCAGGAGTTGGGAAGACCACCTTG
TGCAAAAAGATGGTTTACGATTTCACCTACGGTACACAGACAGAGTTGCATCGTTCATGGAACGAGTCCTTCGAC
CGCTTGCTCTGGGTACCGTTGCGGCATCTGAAAGGACGACCAACCTCAGGATATAGCTACGAGGATTTATTCTAC
CATGAATATTTCTGGGATTTTGACGATGGCCGCCGTCTCGCCGGCGAACTATGGCGAACATTGCGGAACGACGCG
AGCGGCAGAACTTTATTCATTCTTGATGGGCTGGATGAAGTATCCCAGGACATCGTTGGTGCTGGAAACGACATG
TCCCGTTTCTTCCAGCATCTGTTGGACCAGCCCAACGTTATCATCACATCTCGGCCAAACGCCAGCCTCCCAACT
CTCCGACCACTCGATCTTGAACTGGAGACGATTGGATTCTACCCAGATCAGGTTACCGAATATATCAACAAAACA
TGCGACAGTTCAAAAGCCGAACGTATTAAGTTAGTCCTTCAACAGCATTGGCTCATCAAGGGGCTAGTGCGGATT
CCGATCCAGCTGGACGCGCTTTGTTATGCTTGGGATGAGTTCAACACCGGGATAGTACCGAGAACAATGACAGAC
ATATACAAAGCCATTGAGAAAAGGTTGTGGAAAAAGGATGTCGTGCGATTGGGGAAGAAACATGATGGGGAACCG
ATAACACCATATCAGATCGGGCTCTTTGATGTCGAGGATCTCGTCGATAATGAGATCTCCCTACTTGAAGGCGTT
GCTTTCACTGGACTACACAACAACATGATCGACTTCACGCCACAGAATCTAGCGATTATATCGAAGCAGTTCAAG
GACAAGTCCATCTTACTCGATAAGACGCTTCCGCACCTCTCTTTTCTACGAACGTCAGACCCGTTTTCAGAAGAG
GGCAAGCGGGACTATCACTTCTTGCATCTGACCTATCAAGAATATTATGCGGCTCGATATTTCGTGCGCGAATGG
ATCTCTGAACAACCACTTAAATGCCTGGACCTAAACGACAGAAGAACATACAAGATGCTTCCGGTCGAATTTCTT
CATCAGCAGAAATATACGGCACGCTACGACGTTTTTTGGCGCTTCGTCACCGGCTTGCTGGCCGCTGAGGACGAG
GGAGACGCTCGTGATGAGGGAAGAACGCTGAGTTTCCTGCGGACGATCGAACAGGGTCCACTAGACCTTTTGGGC
CCCACGCACCAACGGCTGCTCATGCGTTGCTTGAGCGAGGCATCAGCGAACATCCCAGTGTCATCCAAAGAGTGC
TTGGAGAGGAGCCTGAAGCAGTGGCTCCTCTTCGAATGCACTTTGACACCAGAAGACTCATCGTGGCGATTATTG
TCAAGCGAAATGGAGTTCCCAGACGCGGTCTTAAGCGATACTATGAAAGAGATATCTGACGGCGCGAAAATCAAA
ATTCTACGCTCGCTACATGATCGTCTAGAAACCTTGCCAAGCGTGAATCGGCTGGTGGTTTCTTGGCTGCGTGAC
GACGACATATCTCGGCAATTCATCGCCTCGGTCCTTCAAGTTTATCATTATCATGGTGCAGGCTTGTCTAGCGAT
ACCCTCACGGCTGTGGTCCAGCGACTAGATGATGACCACTCGGGAGTACGAACGGGCGTCATTCGCGTCCTGCAA
GTGCAGCCGGACTTGTCCGATGAGGCCCTCACGGCCGTGATCCAACGACTAGGCGATGAGGACGTACGGGGATAC
GCTCTAGCTATGCTAGCTGATCAGCCGAACTTGTCTGATGAGGTCCTCACGGCTGTGATCCAGCGACTAGGTGAT
GGCAATAGCGAAGTGCGAGAGGGCGCCTTATTTATCCTGAAAGCGCAGAACTTGTCCGATCTGGCCCTCACGGCC
GTGATCCAGCGACTAGGTGATGACGACTGGCGGGTGCGACAGGGCGCCATGAGCGTCCTGAGAGCGCAGCCCAAC
TTGTCCGATGAGGCCCTCACGGCCGTGATCCAGCGACTAGGCGATGACAACGAATACACCCTCACGGCCGTGATC
CAGCGACTGGGCGATGACGACGAAGACGTACGACATTCTGCTCTAGCTGTCCTAGTTCATCAGCCGAACTTGTCC
GATGAGGCCCTCACGGTTGTGATTCAGCGACTAGGCGATGACGACTGGCTAGTGCGAATGGGCGCCATGAAGGTC
TTACGGCGGCTATCGAGCTTATCAGATCAGGCCTTTGCGGCTGTAATCCAACGCCTAGACGATAACGACGAGGGC
ATGCTCAGGACTGCCCGAGAATTTCTATCGCAGTGGCCGACCTCAACTGACAGCTTCCTTGCGGCTGTAATCCAA
CGTCTACGCGACAGCGACGGCTGCATACGGGAGGCTGCCTTGCATTTCTTAAGGAAGGGGCCAGGCCTGCCCAAC
GAATTCCTTATTACCGTAGGACAAATGCTGAGTAACGACGATAGTGCCATACGAAGCGCTGCTATAGATTTTTTG
TCAATTCAGGCTAACGAAGTCCCTTTAGTTATTAGCCAGCTAATGGAGATCTGGGACAGGGGATGGTTGACGGAC
CTGAACTTTCTTTACTTATTAGAGATACAGCCGAGCTTATCCGAGGAGATCCTCACAGTCGTAGTAAGAATGCTA
GACGACGACAACAAACAACCCTATCTAAAAGTTGTCCTAAACGTCCTACAAAAGCAGCCTAGCTTATCCGACGAG
ATCCTCACAATCATAGTCCGAATGCTAGACGACGACGAAGACAGCTATCTACGAATCAAAGCCCTGGAGGTGCTA
CGAAAGCAGCCGAGCTTATCCGACGAGATCCTCACAGTTGTAGTCCGAATGCTAGACGACGACAAAGGAGACCGC
CTGCTACTCAAAACAGTCCTAGGGCTCCTAATGCACCAGTCAGAGTTGTCCGAGGAGATCCTTACCGCCGCAGCG
CAACTACTAGAATCTGAGAGAGCGGGCCACTTAGCAGAGGCCGTACTCAGAAAACATGAAAGATTCTACTCAACC
CTTCTTGTCGGTTCATCAGCGGGATCACTGCTCAAGACCCTGTCGCGCCTCGCCTTTGGAGAACAAGTGAGCTGG
TACATTCAAAATGGAAGGTCATGCATCAACATGCCGGATGGGATTAGGACTTTCGGCATTGATGACGAGGAGGAG
CTCATGAATTTACTCAATGAAGCGCGGCTACCAGACGCTCCACCAGTGGCCGCTGGGTTATAG
Transcript >Ophio5|8181
ATGGCCTCAGTCAACATTGGCTATCTCATTCTTCTGGCTGTGGGAACAGCTTTCTTTTATCTTCGGCTTCGCCGC
GGGCTGCCACGGCCCCCAATCACAATCCCCGCTCGTCAAGAGTCGGCACCATCCGCTGAACCAAGGCGAGGTGTC
CGTCTATGCCAGGTCCCTGCTACGAATAGCTCCGAAGCCGAGACAGATGTCGACATCATCGCCATCCATGGCCTA
GACACGAAGTCGCCAGACACTTGGATCTGGAAGGATAAAAAGAACATAATTCCCCCGGTCAATTGGCTTTCCGAC
TCCCATATGCTCCCGAGCAGAGTCGGACCGGCTCGGATATTCACCTGCGACTGGCCAGCCGACTTATTCGAACCG
TGTGGCCTGACACCGAAAACGAATCAAGAGTTTGCTCGGCGTTTACTCGATGGCATCAAGAGGCGACCGCCACCA
GCCGATGGCCGCACATGTGAAGACCGGCCGATCCTCTTCATTGCGTCTTGCCTCGGGGGTATAGTCTTGATGAAG
GCTCTCGTCATGGCCAATAACGAGTACAGTTGCGTCAGAACCGCCACACGTGGTGTTGTCTTTCTTGCCACTCCA
TTTGGAGGCACTTCGTTCCAGGGAGTGGCCAAGTGGGCAGAGCCGGGCCTCAAGGCCTGGGCTTCTTTAAGACGT
CAAGAAGTGTCGAAGCTGCTCGATAGCGTCAAGCAATCCGTTGATATCGACGAACTTGTCCGAGGCTTCACTCAG
TTATGCCGGGATCCAACCGGGCCCCAAGTCATGACGTTCTATGAACTAGGCGAGACGAACATTTACCACAAGGTC
TTTCCTTCTTTACCAGTTGGATCCAAACCGCTTGTGGATAAGTCTTCAGCGACCCTGCAAATCGTCCCAAATCCT
TTGCCACTCGACAGATGCCACCAGTTGATGAATAAGTTCTGTGGCGACCAGGGCGACGCCAAAGATGACGATTAC
CCTGTTGTGGTTGGAAAAGTTGAGGAGTTTTTGCAAAATATTCGCAAGAAGGACGCGGACGACTGGATCCGGGAT
AACCATTATACCCTGGAGAGGCTCAAGATCGAACGTCTCTCGGGCGAGCCATTGCCGATGGATCAGTGTTACATC
AACCTTGCCATTGTGAAGCAGTGGGAAGACAGCATGAACAGCTCAGATACATCGCAGTCATCCCCGTTTTCACTT
TTTGCCCGTCAAAAAGTTGTTACCCCAGATAAGACGGTTCAGATCGATCTGGCAAAACTCTTCAATGAGCGAGAA
GGGCGCAACGGTCACCAGATAAAACCTAGACGAATATTGATCCGCGGACGCGCAGGAGTTGGGAAGACCACCTTG
TGCAAAAAGATGGTTTACGATTTCACCTACGGTACACAGACAGAGTTGCATCGTTCATGGAACGAGTCCTTCGAC
CGCTTGCTCTGGGTACCGTTGCGGCATCTGAAAGGACGACCAACCTCAGGATATAGCTACGAGGATTTATTCTAC
CATGAATATTTCTGGGATTTTGACGATGGCCGCCGTCTCGCCGGCGAACTATGGCGAACATTGCGGAACGACGCG
AGCGGCAGAACTTTATTCATTCTTGATGGGCTGGATGAAGTATCCCAGGACATCGTTGGTGCTGGAAACGACATG
TCCCGTTTCTTCCAGCATCTGTTGGACCAGCCCAACGTTATCATCACATCTCGGCCAAACGCCAGCCTCCCAACT
CTCCGACCACTCGATCTTGAACTGGAGACGATTGGATTCTACCCAGATCAGGTTACCGAATATATCAACAAAACA
TGCGACAGTTCAAAAGCCGAACGTATTAAGTTAGTCCTTCAACAGCATTGGCTCATCAAGGGGCTAGTGCGGATT
CCGATCCAGCTGGACGCGCTTTGTTATGCTTGGGATGAGTTCAACACCGGGATAGTACCGAGAACAATGACAGAC
ATATACAAAGCCATTGAGAAAAGGTTGTGGAAAAAGGATGTCGTGCGATTGGGGAAGAAACATGATGGGGAACCG
ATAACACCATATCAGATCGGGCTCTTTGATGTCGAGGATCTCGTCGATAATGAGATCTCCCTACTTGAAGGCGTT
GCTTTCACTGGACTACACAACAACATGATCGACTTCACGCCACAGAATCTAGCGATTATATCGAAGCAGTTCAAG
GACAAGTCCATCTTACTCGATAAGACGCTTCCGCACCTCTCTTTTCTACGAACGTCAGACCCGTTTTCAGAAGAG
GGCAAGCGGGACTATCACTTCTTGCATCTGACCTATCAAGAATATTATGCGGCTCGATATTTCGTGCGCGAATGG
ATCTCTGAACAACCACTTAAATGCCTGGACCTAAACGACAGAAGAACATACAAGATGCTTCCGGTCGAATTTCTT
CATCAGCAGAAATATACGGCACGCTACGACGTTTTTTGGCGCTTCGTCACCGGCTTGCTGGCCGCTGAGGACGAG
GGAGACGCTCGTGATGAGGGAAGAACGCTGAGTTTCCTGCGGACGATCGAACAGGGTCCACTAGACCTTTTGGGC
CCCACGCACCAACGGCTGCTCATGCGTTGCTTGAGCGAGGCATCAGCGAACATCCCAGTGTCATCCAAAGAGTGC
TTGGAGAGGAGCCTGAAGCAGTGGCTCCTCTTCGAATGCACTTTGACACCAGAAGACTCATCGTGGCGATTATTG
TCAAGCGAAATGGAGTTCCCAGACGCGGTCTTAAGCGATACTATGAAAGAGATATCTGACGGCGCGAAAATCAAA
ATTCTACGCTCGCTACATGATCGTCTAGAAACCTTGCCAAGCGTGAATCGGCTGGTGGTTTCTTGGCTGCGTGAC
GACGACATATCTCGGCAATTCATCGCCTCGGTCCTTCAAGTTTATCATTATCATGGTGCAGGCTTGTCTAGCGAT
ACCCTCACGGCTGTGGTCCAGCGACTAGATGATGACCACTCGGGAGTACGAACGGGCGTCATTCGCGTCCTGCAA
GTGCAGCCGGACTTGTCCGATGAGGCCCTCACGGCCGTGATCCAACGACTAGGCGATGAGGACGTACGGGGATAC
GCTCTAGCTATGCTAGCTGATCAGCCGAACTTGTCTGATGAGGTCCTCACGGCTGTGATCCAGCGACTAGGTGAT
GGCAATAGCGAAGTGCGAGAGGGCGCCTTATTTATCCTGAAAGCGCAGAACTTGTCCGATCTGGCCCTCACGGCC
GTGATCCAGCGACTAGGTGATGACGACTGGCGGGTGCGACAGGGCGCCATGAGCGTCCTGAGAGCGCAGCCCAAC
TTGTCCGATGAGGCCCTCACGGCCGTGATCCAGCGACTAGGCGATGACAACGAATACACCCTCACGGCCGTGATC
CAGCGACTGGGCGATGACGACGAAGACGTACGACATTCTGCTCTAGCTGTCCTAGTTCATCAGCCGAACTTGTCC
GATGAGGCCCTCACGGTTGTGATTCAGCGACTAGGCGATGACGACTGGCTAGTGCGAATGGGCGCCATGAAGGTC
TTACGGCGGCTATCGAGCTTATCAGATCAGGCCTTTGCGGCTGTAATCCAACGCCTAGACGATAACGACGAGGGC
ATGCTCAGGACTGCCCGAGAATTTCTATCGCAGTGGCCGACCTCAACTGACAGCTTCCTTGCGGCTGTAATCCAA
CGTCTACGCGACAGCGACGGCTGCATACGGGAGGCTGCCTTGCATTTCTTAAGGAAGGGGCCAGGCCTGCCCAAC
GAATTCCTTATTACCGTAGGACAAATGCTGAGTAACGACGATAGTGCCATACGAAGCGCTGCTATAGATTTTTTG
TCAATTCAGGCTAACGAAGTCCCTTTAGTTATTAGCCAGCTAATGGAGATCTGGGACAGGGGATGGTTGACGGAC
CTGAACTTTCTTTACTTATTAGAGATACAGCCGAGCTTATCCGAGGAGATCCTCACAGTCGTAGTAAGAATGCTA
GACGACGACAACAAACAACCCTATCTAAAAGTTGTCCTAAACGTCCTACAAAAGCAGCCTAGCTTATCCGACGAG
ATCCTCACAATCATAGTCCGAATGCTAGACGACGACGAAGACAGCTATCTACGAATCAAAGCCCTGGAGGTGCTA
CGAAAGCAGCCGAGCTTATCCGACGAGATCCTCACAGTTGTAGTCCGAATGCTAGACGACGACAAAGGAGACCGC
CTGCTACTCAAAACAGTCCTAGGGCTCCTAATGCACCAGTCAGAGTTGTCCGAGGAGATCCTTACCGCCGCAGCG
CAACTACTAGAATCTGAGAGAGCGGGCCACTTAGCAGAGGCCGTACTCAGAAAACATGAAAGATTCTACTCAACC
CTTCTTGTCGGTTCATCAGCGGGATCACTGCTCAAGACCCTGTCGCGCCTCGCCTTTGGAGAACAAGTGAGCTGG
TACATTCAAAATGGAAGGTCATGCATCAACATGCCGGATGGGATTAGGACTTTCGGCATTGATGACGAGGAGGAG
CTCATGAATTTACTCAATGAAGCGCGGCTACCAGACGCTCCACCAGTGGCCGCTGGGTTATAG
Gene >Ophio5|8181
ATGGCCTCAGTCAACATTGGCTATCTCATTCTTCTGGCTGTGGGAACAGCTTTCTTTTATCTTCGGCTTCGCCGC
GGGCTGCCACGGCCCCCAATCACAATCCCCGCTCGTCAAGAGTCGGCACCATCCGCTGAACCAAGGCGAGGTGTC
CGTCTATGCCAGGTCCCTGCTACGAATAGCTCCGAAGCCGAGACAGATGTCGACATCATCGCCATCCATGGCCTA
GACACGAAGTCGCCAGACACTTGGATCTGGAAGGATAAAAAGAACATAATTCCCCCGGTCAATTGGCTTTCCGAC
TCCCATATGCTCCCGAGCAGAGTCGGACCGGCTCGGATATTCACCTGCGACTGGCCAGCCGACTTATTCGAACCG
TGTGGCCTGACACCGAAAACGAATCAAGAGTTTGCTCGGCGTTTACTCGATGGCATCAAGAGGCGACCGCCACCA
GCCGATGGCCGCACATGTGAAGACCGGCCGATCCTCTTCATTGCGTCTTGCCTCGGGGGTATAGTCTTGATGAAG
GCTCTCGTCATGGCCAATAACGAGTACAGTTGCGTCAGAACCGCCACACGTGGTGTTGTCTTTCTTGCCACTCCA
TTTGGAGGCACTTCGTTCCAGGGAGTGGCCAAGTGGGCAGAGCCGGGCCTCAAGGCCTGGGCTTCTTTAAGACGT
CAAGAAGTGTCGAAGCTGCTCGATAGCGTCAAGCAATCCGTTGATATCGACGAACTTGTCCGAGGCTTCACTCAG
TTATGCCGGGATCCAACCGGGCCCCAAGTCATGACGTTCTATGAACTAGGCGAGACGAACATTTACCACAAGGTC
TTTCCTTCTTTACCAGTTGGATCCAAACCGGTAAGACTGATGAACTACAACGTCCCTACCTGTGTCATCGTGCCG
GGTGGCAGGGAGAAAAACATTGCTGATTGTTGCTAGCTTGTGGATAAGTCTTCAGCGACCCTGCAAATCGTCCCA
AATCCTTTGCCACTCGACAGATGCCACCAGTTGATGAATAAGTTCTGTGGCGACCAGGGCGACGCCAAAGATGAC
GATTACCCTGTTGTGGTTGGAAAAGTTGAGGAGTTTTTGCAAAATATTCGCAAGAAGGACGCGGACGACTGGATC
CGGGATAACCATTATACCCTGGAGAGGCTCAAGATCGAACGTCTCTCGGGCGAGCCATTGCCGATGGATCAGTGT
TACATCAACCTTGCCATTGTGAAGCAGTGGGAAGACAGCATGAACAGCTCAGATACATCGCAGTCATCCCCGTTT
TCACTTTTTGCCCGTCAAAAAGTTGTTACCCCAGATAAGACGGTTCAGATCGATCTGGCAAAACTCTTCAATGAG
CGAGAAGGGCGCAACGGTCACCAGATAAAACCTAGACGAATATTGATCCGCGGACGCGCAGGAGTTGGGAAGACC
ACCTTGTGCAAAAAGATGGTTTACGATTTCACCTACGGTACACAGACAGAGTTGCATCGTTCATGGAACGAGTCC
TTCGACCGCTTGCTCTGGGTACCGTTGCGGCATCTGAAAGGACGACCAACCTCAGGATATAGCTACGAGGATTTA
TTCTACCATGAATATTTCTGGGATTTTGACGATGGCCGCCGTCTCGCCGGCGAACTATGGCGAACATTGCGGAAC
GACGCGAGCGGCAGAACTTTATTCATTCTTGATGGGCTGGATGAAGTATCCCAGGACATCGTTGGTGCTGGAAAC
GACATGTCCCGTTTCTTCCAGCATCTGTTGGACCAGCCCAACGTTATCATCACATCTCGGCCAAACGCCAGCCTC
CCAACTCTCCGACCACTCGATCTTGAACTGGAGACGATTGGATTCTACCCAGATCAGGTTACCGAATATATCAAC
AAAACATGCGACAGTTCAAAAGCCGAACGTATTAAGTTAGTCCTTCAACAGCATTGGCTCATCAAGGGGCTAGTG
CGGATTCCGATCCAGCTGGACGCGCTTTGTTATGCTTGGGATGAGTTCAACACCGGGATAGTACCGAGAACAATG
ACAGACATATACAAAGCCATTGAGAAAAGGTTGTGGAAAAAGGATGTCGTGCGATTGGGGAAGAAACATGATGGG
GAACCGATAACACCATATCAGATCGGGCTCTTTGATGTCGAGGATCTCGTCGATAATGAGATCTCCCTACTTGAA
GGCGTTGCTTTCACTGGACTACACAACAACATGATCGACTTCACGCCACAGAATCTAGCGATTATATCGAAGCAG
TTCAAGGACAAGTCCATCTTACTCGATAAGACGCTTCCGCACCTCTCTTTTCTACGAACGTCAGACCCGTTTTCA
GAAGAGGGCAAGCGGGACTATCACTTCTTGCATCTGACCTATCAAGAATATTATGCGGCTCGATATTTCGTGCGC
GAATGGATCTCTGAACAACCACTTAAATGCCTGGACCTAAACGACAGAAGAACATACAAGATGCTTCCGGTCGAA
TTTCTTCATCAGCAGAAATATACGGCACGCTACGACGTTTTTTGGCGCTTCGTCACCGGCTTGCTGGCCGCTGAG
GACGAGGGAGACGCTCGTGATGAGGGAAGAACGCTGAGTTTCCTGCGGACGATCGAACAGGGTCCACTAGACCTT
TTGGGCCCCACGCACCAACGGCTGCTCATGCGTTGCTTGAGCGAGGCATCAGCGAACATCCCAGTGTCATCCAAA
GAGTGCTTGGAGAGGAGCCTGAAGCAGTGGCTCCTCTTCGAATGCACTTTGACACCAGAAGACTCATCGTGGCGA
TTATTGTCAAGCGAAATGGAGTTCCCAGACGCGGTCTTAAGCGATACTATGAAAGAGATATCTGACGGCGCGAAA
ATCAAAATTCTACGCTCGCTACATGATCGTCTAGAAACCTTGCCAAGCGTGAATCGGCTGGTGGTTTCTTGGCTG
CGTGACGACGACATATCTCGGCAATTCATCGCCTCGGTCCTTCAAGTTTATCATTATCATGGTGCAGGCTTGTCT
AGCGATACCCTCACGGCTGTGGTCCAGCGACTAGATGATGACCACTCGGGAGTACGAACGGGCGTCATTCGCGTC
CTGCAAGTGCAGCCGGACTTGTCCGATGAGGCCCTCACGGCCGTGATCCAACGACTAGGCGATGAGGACGTACGG
GGATACGCTCTAGCTATGCTAGCTGATCAGCCGAACTTGTCTGATGAGGTCCTCACGGCTGTGATCCAGCGACTA
GGTGATGGCAATAGCGAAGTGCGAGAGGGCGCCTTATTTATCCTGAAAGCGCAGAACTTGTCCGATCTGGCCCTC
ACGGCCGTGATCCAGCGACTAGGTGATGACGACTGGCGGGTGCGACAGGGCGCCATGAGCGTCCTGAGAGCGCAG
CCCAACTTGTCCGATGAGGCCCTCACGGCCGTGATCCAGCGACTAGGCGATGACAACGAATACGTACGACAATAT
GCTCTAGATGTCCTGAAAGTGCAGCCTAACTTGTCCGATGAGACCCTCACGGCCGTGATCCAGCGACTGGGCGAT
GACGACGAAGACGTACGACATTCTGCTCTAGCTGTCCTAGTTCATCAGCCGAACTTGTCCGATGAGGCCCTCACG
GTTGTGATTCAGCGACTAGGCGATGACGACTGGCTAGTGCGAATGGGCGCCATGAAGGTCTTACGGCGGCTATCG
AGCTTATCAGATCAGGCCTTTGCGGCTGTAATCCAACGCCTAGACGATAACGACGAGGGCATGCTCAGGACTGCC
CGAGAATTTCTATCGCAGTGGCCGACCTCAACTGACAGCTTCCTTGCGGCTGTAATCCAACGTCTACGCGACAGC
GACGGCTGCATACGGGAGGCTGCCTTGCATTTCTTAAGGAAGGGGCCAGGCCTGCCCAACGAATTCCTTATTACC
GTAGGACAAATGCTGAGTAACGACGATAGTGCCATACGAAGCGCTGCTATAGATTTTTTGTCAATTCAGGCTAAC
GAAGTCCCTTTAGTTATTAGCCAGCTAATGGAGATCTGGGACAGGGGATGGTTGACGGACCTGAACTTTCTTTAC
TTATTAGAGATACAGCCGAGCTTATCCGAGGAGATCCTCACAGTCGTAGTAAGAATGCTAGACGACGACAACAAA
CAACCCTATCTAAAAGTTGTCCTAAACGTCCTACAAAAGCAGCCTAGCTTATCCGACGAGATCCTCACAATCATA
GTCCGAATGCTAGACGACGACGAAGACAGCTATCTACGAATCAAAGCCCTGGAGGTGCTACGAAAGCAGCCGAGC
TTATCCGACGAGATCCTCACAGTTGTAGTCCGAATGCTAGACGACGACAAAGGAGACCGCCTGCTACTCAAAACA
GTCCTAGGGCTCCTAATGCACCAGTCAGAGTTGTCCGAGGAGATCCTTACCGCCGCAGCGCAACTACTAGAATCT
GAGAGAGCGGGCCACTTAGCAGAGGCCGTACTCAGAAAACATGAAAGATTCTACTCAACCCTTCTTGTCGGTTCA
TCAGCGGGATCACTGCTCAAGACCCTGTCGCGCCTCGCCTTTGGAGAACAAGTGAGCTGGTACATTCAAAATGGA
AGGTCATGCATCAACATGCCGGATGGGATTAGGACTTTCGGCATTGATGACGAGGAGGAGCTCATGAATTTACTC
AATGAAGCGCGGCTACCAGACGCTCCACCAGTGGCCGCTGGGTTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail