Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8175
Gene name
Locationscaffold_878:2207..2716
Strand+
Gene length (bp)509
Transcript length (bp)456
Coding sequence length (bp)453
Protein length (aa) 151

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12273 RCR Chitin synthesis regulation, resistance to Congo red 2.7E-24 22 149

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q03446|RCR2_YEAST Protein RCR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RCR2 PE=1 SV=1 20 76 7.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.5

Transmembrane Domains

Domain # Start End Length
1 20 42 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8175
MATLECINGVCRRRNRWFDWGRWAFLGLILIGFLIVFFLFACIARRRRRRGAQPMYGTGWMAPNGKYGGQDGNYN
GQPQQGYGQPGFAPPPPPAYGQPQYPQPTGTTGTNFHPNDGYYGDASQQYGVQHPPTAYQPNSGPYSPPPGPPPG
K
Coding >Ophio5|8175
ATGGCGACCCTTGAGTGCATCAACGGTGTGTGTCGGAGACGCAACCGCTGGTTCGACTGGGGACGATGGGCATTC
TTGGGCCTCATCCTCATCGGCTTCCTCATCGTCTTCTTCCTCTTTGCATGCATTGCCCGTCGTCGTCGTCGTCGT
GGCGCCCAGCCCATGTACGGTACCGGATGGATGGCACCGAACGGCAAATACGGAGGGCAGGACGGCAATTACAAC
GGGCAACCGCAGCAGGGATACGGCCAGCCGGGGTTTGCGCCGCCGCCGCCGCCGGCGTACGGTCAGCCGCAGTAT
CCCCAGCCGACGGGCACGACGGGCACCAATTTCCACCCCAACGACGGCTACTACGGCGACGCTTCGCAGCAGTAC
GGCGTTCAGCATCCGCCCACGGCCTATCAACCCAACTCAGGACCCTACTCGCCGCCTCCCGGTCCGCCGCCCGGA
AAG
Transcript >Ophio5|8175
ATGGCGACCCTTGAGTGCATCAACGGTGTGTGTCGGAGACGCAACCGCTGGTTCGACTGGGGACGATGGGCATTC
TTGGGCCTCATCCTCATCGGCTTCCTCATCGTCTTCTTCCTCTTTGCATGCATTGCCCGTCGTCGTCGTCGTCGT
GGCGCCCAGCCCATGTACGGTACCGGATGGATGGCACCGAACGGCAAATACGGAGGGCAGGACGGCAATTACAAC
GGGCAACCGCAGCAGGGATACGGCCAGCCGGGGTTTGCGCCGCCGCCGCCGCCGGCGTACGGTCAGCCGCAGTAT
CCCCAGCCGACGGGCACGACGGGCACCAATTTCCACCCCAACGACGGCTACTACGGCGACGCTTCGCAGCAGTAC
GGCGTTCAGCATCCGCCCACGGCCTATCAACCCAACTCAGGACCCTACTCGCCGCCTCCCGGTCCGCCGCCCGGA
AAGTGA
Gene >Ophio5|8175
ATGGCGACCCTTGAGTGCATCAACGGTGTGTGTCGGAGACGCAACCGCTGGTTCGACTGGGGACGATGGGCATTC
TTGGGCCTCATCCTCATCGGCTTCCTCATCGTCTTCTTCCTCTTTGCGTGAGTGAGGACGAAAATGCATACGACG
CAAGCCTCAGCTGACAAGTAAGCAGATGCATTGCCCGTCGTCGTCGTCGTCGTGGCGCCCAGCCCATGTACGGTA
CCGGATGGATGGCACCGAACGGCAAATACGGAGGGCAGGACGGCAATTACAACGGGCAACCGCAGCAGGGATACG
GCCAGCCGGGGTTTGCGCCGCCGCCGCCGCCGGCGTACGGTCAGCCGCAGTATCCCCAGCCGACGGGCACGACGG
GCACCAATTTCCACCCCAACGACGGCTACTACGGCGACGCTTCGCAGCAGTACGGCGTTCAGCATCCGCCCACGG
CCTATCAACCCAACTCAGGACCCTACTCGCCGCCTCCCGGTCCGCCGCCCGGAAAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail