Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8150
Gene name
Locationscaffold_87:36401..37791
Strand+
Gene length (bp)1390
Transcript length (bp)1302
Coding sequence length (bp)1299
Protein length (aa) 433

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00134 Cyclin_N Cyclin, N-terminal domain 2.6E-10 99 217

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74627|CG1C_SCHPO Cyclin pch1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pch1 PE=1 SV=1 58 395 5.0E-52
sp|Q2RAC5|CCT13_ORYSJ Cyclin-T1-3 OS=Oryza sativa subsp. japonica GN=CYCT1-3 PE=3 SV=2 73 315 1.0E-26
sp|Q2QQS5|CCT14_ORYSJ Cyclin-T1-4 OS=Oryza sativa subsp. japonica GN=CYCT1-1 PE=2 SV=1 73 323 2.0E-26
sp|Q9AS36|CCL11_ORYSJ Cyclin-L1-1 OS=Oryza sativa subsp. japonica GN=CYCL1-1 PE=2 SV=1 76 393 4.0E-26
sp|O88874|CCNK_MOUSE Cyclin-K OS=Mus musculus GN=Ccnk PE=1 SV=3 76 358 5.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74627|CG1C_SCHPO Cyclin pch1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pch1 PE=1 SV=1 58 395 5.0E-52
sp|Q2RAC5|CCT13_ORYSJ Cyclin-T1-3 OS=Oryza sativa subsp. japonica GN=CYCT1-3 PE=3 SV=2 73 315 1.0E-26
sp|Q2QQS5|CCT14_ORYSJ Cyclin-T1-4 OS=Oryza sativa subsp. japonica GN=CYCT1-1 PE=2 SV=1 73 323 2.0E-26
sp|Q9AS36|CCL11_ORYSJ Cyclin-L1-1 OS=Oryza sativa subsp. japonica GN=CYCL1-1 PE=2 SV=1 76 393 4.0E-26
sp|O88874|CCNK_MOUSE Cyclin-K OS=Mus musculus GN=Ccnk PE=1 SV=3 76 358 5.0E-26
sp|Q9FKE6|CCT15_ARATH Cyclin-T1-5 OS=Arabidopsis thaliana GN=CYCT1-5 PE=1 SV=2 75 315 8.0E-25
sp|O75909|CCNK_HUMAN Cyclin-K OS=Homo sapiens GN=CCNK PE=1 SV=2 76 310 1.0E-24
sp|Q8GYM6|CCT14_ARATH Cyclin-T1-4 OS=Arabidopsis thaliana GN=CYCT1-4 PE=1 SV=1 75 315 7.0E-24
sp|Q6GN15|CCNL1_XENLA Cyclin-L1 OS=Xenopus laevis GN=ccnl1 PE=2 SV=2 46 299 1.0E-22
sp|Q5BKF8|CCNL2_XENTR Cyclin-L2 OS=Xenopus tropicalis GN=ccnl2 PE=2 SV=1 81 373 6.0E-22
sp|Q5I0H5|CCNL2_RAT Cyclin-L2 OS=Rattus norvegicus GN=Ccnl2 PE=1 SV=2 81 423 1.0E-21
sp|Q9JJA7|CCNL2_MOUSE Cyclin-L2 OS=Mus musculus GN=Ccnl2 PE=1 SV=1 81 423 2.0E-21
sp|Q7ZVX0|CCNL1_DANRE Cyclin-L1 OS=Danio rerio GN=ccnl1 PE=1 SV=1 52 320 3.0E-21
sp|Q8RWV3|CCL11_ARATH Cyclin-L1-1 OS=Arabidopsis thaliana GN=CYCL1-1 PE=1 SV=2 75 313 2.0E-20
sp|Q5ZJP9|CCNL1_CHICK Cyclin-L1 OS=Gallus gallus GN=CCNL1 PE=2 SV=1 86 368 4.0E-20
sp|Q9UK58|CCNL1_HUMAN Cyclin-L1 OS=Homo sapiens GN=CCNL1 PE=1 SV=1 68 275 4.0E-20
sp|Q52KE7|CCNL1_MOUSE Cyclin-L1 OS=Mus musculus GN=Ccnl1 PE=1 SV=1 77 275 4.0E-20
sp|Q9R1Q2|CCNL1_RAT Cyclin-L1 OS=Rattus norvegicus GN=Ccnl1 PE=1 SV=1 77 275 5.0E-20
sp|Q9QWV9|CCNT1_MOUSE Cyclin-T1 OS=Mus musculus GN=Ccnt1 PE=1 SV=3 76 296 8.0E-20
sp|Q9XT26|CCNT1_HORSE Cyclin-T1 OS=Equus caballus GN=CCNT1 PE=1 SV=1 76 314 1.0E-19
sp|O60563|CCNT1_HUMAN Cyclin-T1 OS=Homo sapiens GN=CCNT1 PE=1 SV=1 76 296 2.0E-19
sp|Q6T8E9|CCNT1_BOVIN Cyclin-T1 OS=Bos taurus GN=CCNT1 PE=1 SV=1 76 296 2.0E-19
sp|Q8HXN7|CCNT1_PANTR Cyclin-T1 OS=Pan troglodytes GN=CCNT1 PE=2 SV=1 71 296 2.0E-19
sp|Q6Z7H3|CCT12_ORYSJ Cyclin-T1-2 OS=Oryza sativa subsp. japonica GN=CYCT1_2 PE=2 SV=2 64 291 2.0E-18
sp|Q0E474|CCT11_ORYSJ Cyclin-T1-1 OS=Oryza sativa subsp. japonica GN=CYCT1-1 PE=3 SV=2 76 328 3.0E-18
sp|O60583|CCNT2_HUMAN Cyclin-T2 OS=Homo sapiens GN=CCNT2 PE=1 SV=2 76 295 6.0E-18
sp|Q56YF8|CCT12_ARATH Cyclin-T1-2 OS=Arabidopsis thaliana GN=CYCT1-2 PE=2 SV=2 62 259 1.0E-17
sp|Q96S94|CCNL2_HUMAN Cyclin-L2 OS=Homo sapiens GN=CCNL2 PE=1 SV=1 81 406 1.0E-15
sp|Q8N1B3|FA58A_HUMAN Cyclin-related protein FAM58A OS=Homo sapiens GN=FAM58A PE=1 SV=2 95 297 4.0E-15
sp|O96433|CCNT_DROME Cyclin-T OS=Drosophila melanogaster GN=CycT PE=1 SV=2 76 314 6.0E-15
sp|Q8QZR8|FA58B_MOUSE Cyclin-related protein FAM58B OS=Mus musculus GN=Fam58b PE=2 SV=2 95 297 2.0E-13
sp|Q8LBC0|CCT13_ARATH Cyclin-T1-3 OS=Arabidopsis thaliana GN=CYCT1-3 PE=1 SV=2 75 291 4.0E-13
sp|Q9C8P7|CCT11_ARATH Putative cyclin-T1-1 OS=Arabidopsis thaliana GN=CYCT1-1 PE=3 SV=1 76 315 3.0E-12
sp|Q4QQW5|FA58A_RAT Cyclin-related protein FAM58A OS=Rattus norvegicus GN=Fam58a PE=2 SV=1 108 297 4.0E-12
sp|Q6NRK9|FA58A_XENLA Cyclin-related protein FAM58A OS=Xenopus laevis GN=fam58a PE=2 SV=2 104 274 2.0E-11
sp|Q5RD50|CCNL1_PONAB Cyclin-L1 OS=Pongo abelii GN=CCNL1 PE=3 SV=1 68 173 2.0E-10
sp|Q9FJK6|CCC11_ARATH Cyclin-C1-1 OS=Arabidopsis thaliana GN=CYCC1-1 PE=2 SV=2 74 286 4.0E-10
sp|Q503D6|FA58A_DANRE Cyclin-related protein FAM58A OS=Danio rerio GN=fam58a PE=2 SV=1 108 247 2.0E-09
sp|P93411|CCC11_ORYSJ Cyclin-C1-1 OS=Oryza sativa subsp. japonica GN=Os09g0504400 PE=2 SV=1 92 282 3.0E-09
sp|Q9FJK7|CCC12_ARATH Cyclin-C1-2 OS=Arabidopsis thaliana GN=CYCC1-2 PE=2 SV=1 80 297 2.0E-08
sp|P34425|CCNT1_CAEEL Cyclin-T1.1 OS=Caenorhabditis elegans GN=cit-1.1 PE=3 SV=1 56 291 9.0E-08
sp|Q16JA2|CCNC_AEDAE Cyclin-C OS=Aedes aegypti GN=CycC PE=3 SV=1 107 300 2.0E-07
sp|Q7QB13|CCNC_ANOGA Cyclin-C OS=Anopheles gambiae GN=CycC PE=3 SV=2 107 300 6.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

Domain # Start End Length
1 108 130 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 50.43 27.19 73.67
CcL In ants, during behavior modification 62.73 33.76 91.70
CcD In ants, recently dead 52.83 28.48 77.19

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.374113 no
SC16a CcD 0.871383 no
CcL CcD 0.495350 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8150
MASIDRYRPPREGYQPPSLPGAVRNEQMSRSPPHRREVPPAAPTPPQHSARTSPPRSSAQPGQQSPTSSVRRGYQ
WSFTPEEVSSSPTIVHGVAPAEERLRRAKGVNFIYQAGVVLDLPQITLWVAGVFFHRFFMRKSMVEEKGGIHHYN
IAATALFLANKVEENCRKTKDIIIAVVKVAQKNAKLVIDEQSKEYWRWRDSILMYEESMLEHLTFDLMIDNPYRH
LFEILGQLDIVHNKNLRQAAWAFCNDACLTALPLLIEARDVAISAIFFASVHTSQQVDDIHGEPWWKYLNGDEER
CTRAIEVMRQFYTENPLRKQNPSLPSPPYDLENTRRRADALMSQPDALSSAGGTPMVDRASRSPAPKTNGTERGA
EAKERDAKTAPPPRGVEGADTVTRSTPKRREADVDMSSSQERAEKRTRLSEDEGEVEE
Coding >Ophio5|8150
ATGGCGAGCATCGACCGCTACCGGCCTCCTCGCGAAGGCTACCAGCCGCCGAGTCTTCCGGGAGCTGTTCGAAAC
GAGCAGATGTCGCGATCCCCTCCTCACCGGCGCGAGGTTCCGCCTGCTGCGCCGACTCCGCCCCAGCACAGCGCG
CGGACATCTCCGCCGCGATCCAGCGCCCAACCCGGCCAGCAGTCGCCCACGTCATCCGTTAGGCGAGGCTATCAG
TGGTCTTTTACGCCGGAGGAGGTCTCCAGTTCCCCGACCATCGTCCACGGCGTGGCCCCGGCCGAGGAGAGGCTG
CGCAGGGCCAAGGGCGTTAACTTCATCTACCAGGCCGGCGTCGTGCTCGACCTGCCGCAGATCACCCTATGGGTA
GCCGGCGTTTTCTTCCACAGGTTCTTCATGCGTAAGAGCATGGTTGAGGAAAAGGGCGGCATTCATCACTACAAC
ATCGCCGCCACCGCGCTTTTCCTTGCAAATAAGGTCGAGGAGAACTGCCGAAAAACCAAAGACATCATCATCGCG
GTGGTCAAGGTCGCACAGAAAAACGCCAAGCTCGTCATCGATGAGCAGAGCAAGGAGTATTGGCGATGGAGGGAC
AGCATCCTCATGTACGAAGAGAGCATGCTGGAGCACCTCACCTTTGACCTCATGATAGATAACCCCTATCGACAT
CTCTTTGAGATCCTCGGACAGCTCGACATTGTTCACAATAAGAACTTGAGACAGGCTGCATGGGCATTCTGCAAC
GACGCGTGCCTCACGGCGTTGCCACTGCTCATCGAGGCAAGGGACGTCGCCATCAGTGCCATCTTCTTCGCCAGC
GTTCATACGAGCCAACAGGTCGACGACATCCACGGCGAACCGTGGTGGAAGTACCTCAACGGGGACGAGGAGCGC
TGCACGAGGGCCATCGAGGTTATGCGCCAATTCTACACTGAGAATCCACTCAGAAAGCAGAATCCATCGCTGCCA
TCACCTCCCTACGACCTGGAGAACACGAGACGGAGGGCGGACGCGCTCATGAGCCAGCCGGACGCGCTGTCGTCG
GCGGGAGGGACACCCATGGTCGATCGAGCCAGCCGCAGCCCGGCGCCCAAGACTAACGGCACCGAAAGGGGCGCC
GAAGCCAAGGAGCGGGATGCGAAAACGGCACCACCGCCCCGTGGGGTGGAAGGTGCCGATACCGTTACGAGATCA
ACGCCGAAGAGGAGAGAGGCAGATGTGGACATGAGCTCCAGCCAGGAGCGAGCTGAGAAACGAACCAGGCTGTCG
GAGGACGAAGGCGAGGTAGAGGAG
Transcript >Ophio5|8150
ATGGCGAGCATCGACCGCTACCGGCCTCCTCGCGAAGGCTACCAGCCGCCGAGTCTTCCGGGAGCTGTTCGAAAC
GAGCAGATGTCGCGATCCCCTCCTCACCGGCGCGAGGTTCCGCCTGCTGCGCCGACTCCGCCCCAGCACAGCGCG
CGGACATCTCCGCCGCGATCCAGCGCCCAACCCGGCCAGCAGTCGCCCACGTCATCCGTTAGGCGAGGCTATCAG
TGGTCTTTTACGCCGGAGGAGGTCTCCAGTTCCCCGACCATCGTCCACGGCGTGGCCCCGGCCGAGGAGAGGCTG
CGCAGGGCCAAGGGCGTTAACTTCATCTACCAGGCCGGCGTCGTGCTCGACCTGCCGCAGATCACCCTATGGGTA
GCCGGCGTTTTCTTCCACAGGTTCTTCATGCGTAAGAGCATGGTTGAGGAAAAGGGCGGCATTCATCACTACAAC
ATCGCCGCCACCGCGCTTTTCCTTGCAAATAAGGTCGAGGAGAACTGCCGAAAAACCAAAGACATCATCATCGCG
GTGGTCAAGGTCGCACAGAAAAACGCCAAGCTCGTCATCGATGAGCAGAGCAAGGAGTATTGGCGATGGAGGGAC
AGCATCCTCATGTACGAAGAGAGCATGCTGGAGCACCTCACCTTTGACCTCATGATAGATAACCCCTATCGACAT
CTCTTTGAGATCCTCGGACAGCTCGACATTGTTCACAATAAGAACTTGAGACAGGCTGCATGGGCATTCTGCAAC
GACGCGTGCCTCACGGCGTTGCCACTGCTCATCGAGGCAAGGGACGTCGCCATCAGTGCCATCTTCTTCGCCAGC
GTTCATACGAGCCAACAGGTCGACGACATCCACGGCGAACCGTGGTGGAAGTACCTCAACGGGGACGAGGAGCGC
TGCACGAGGGCCATCGAGGTTATGCGCCAATTCTACACTGAGAATCCACTCAGAAAGCAGAATCCATCGCTGCCA
TCACCTCCCTACGACCTGGAGAACACGAGACGGAGGGCGGACGCGCTCATGAGCCAGCCGGACGCGCTGTCGTCG
GCGGGAGGGACACCCATGGTCGATCGAGCCAGCCGCAGCCCGGCGCCCAAGACTAACGGCACCGAAAGGGGCGCC
GAAGCCAAGGAGCGGGATGCGAAAACGGCACCACCGCCCCGTGGGGTGGAAGGTGCCGATACCGTTACGAGATCA
ACGCCGAAGAGGAGAGAGGCAGATGTGGACATGAGCTCCAGCCAGGAGCGAGCTGAGAAACGAACCAGGCTGTCG
GAGGACGAAGGCGAGGTAGAGGAGTGA
Gene >Ophio5|8150
ATGGCGAGCATCGACCGCTACCGGCCTCCTCGCGAAGGCTACCAGCCGCCGAGTCTTCCGGGAGCTGTTCGAAAC
GAGCAGATGTCGCGATCCCCTCCTCACCGGCGCGAGGTTCCGCCTGCTGCGCCGACTCCGCCCCAGCACAGCGCG
CGGACATCTCCGCCGCGATCCAGCGCCCAACCCGGCCAGCAGTCGCCCACGTCATCCGTTAGGCGAGGCTATCAG
TGGTCTTTTACGCCGGAGGAGGTCTCCAGTTCCCCGACCATCGTCCACGGCGTGGCCCCGGCCGAGGAGAGGCTG
CGCAGGGCCAAGGGCGTTAACTTCATCTACCAGGCCGGCGTCGTGCTCGACCTGCCGCAGATCACCCTATGGGTA
GCCGGCGTTTTCTTCCACAGGTTCTTCATGCGTAAGAGCATGGTTGAGGAAAAGGGCGGCATTCATCACTACGTG
AGCATTCCTTTTCGTCGGCGCGGAGATGTCACCGTCTCTCCCGGCCTCCTTCCCTTCCGCCGAAGAATGGCTGAC
GACGTTGTAGAACATCGCCGCCACCGCGCTTTTCCTTGCAAATAAGGTCGAGGAGAACTGCCGAAAAACCAAAGA
CATCATCATCGCGGTGGTCAAGGTCGCACAGAAAAACGCCAAGCTCGTCATCGATGAGCAGAGCAAGGAGTATTG
GCGATGGAGGGACAGCATCCTCATGTACGAAGAGAGCATGCTGGAGCACCTCACCTTTGACCTCATGATAGATAA
CCCCTATCGACATCTCTTTGAGATCCTCGGACAGCTCGACATTGTTCACAATAAGAACTTGAGACAGGCTGCATG
GGCATTCTGCAACGACGCGTGCCTCACGGCGTTGCCACTGCTCATCGAGGCAAGGGACGTCGCCATCAGTGCCAT
CTTCTTCGCCAGCGTTCATACGAGCCAACAGGTCGACGACATCCACGGCGAACCGTGGTGGAAGTACCTCAACGG
GGACGAGGAGCGCTGCACGAGGGCCATCGAGGTTATGCGCCAATTCTACACTGAGAATCCACTCAGAAAGCAGAA
TCCATCGCTGCCATCACCTCCCTACGACCTGGAGAACACGAGACGGAGGGCGGACGCGCTCATGAGCCAGCCGGA
CGCGCTGTCGTCGGCGGGAGGGACACCCATGGTCGATCGAGCCAGCCGCAGCCCGGCGCCCAAGACTAACGGCAC
CGAAAGGGGCGCCGAAGCCAAGGAGCGGGATGCGAAAACGGCACCACCGCCCCGTGGGGTGGAAGGTGCCGATAC
CGTTACGAGATCAACGCCGAAGAGGAGAGAGGCAGATGTGGACATGAGCTCCAGCCAGGAGCGAGCTGAGAAACG
AACCAGGCTGTCGGAGGACGAAGGCGAGGTAGAGGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail