Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8150
Gene name
Locationscaffold_87:36401..37791
Strand+
Gene length (bp)1390
Transcript length (bp)1302
Coding sequence length (bp)1299
Protein length (aa) 433

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00134 Cyclin_N Cyclin, N-terminal domain 2.6E-10 99 217

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74627|CG1C_SCHPO Cyclin pch1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pch1 PE=1 SV=1 58 395 5.0E-52
sp|Q2RAC5|CCT13_ORYSJ Cyclin-T1-3 OS=Oryza sativa subsp. japonica GN=CYCT1-3 PE=3 SV=2 73 315 1.0E-26
sp|Q2QQS5|CCT14_ORYSJ Cyclin-T1-4 OS=Oryza sativa subsp. japonica GN=CYCT1-1 PE=2 SV=1 73 323 2.0E-26
sp|Q9AS36|CCL11_ORYSJ Cyclin-L1-1 OS=Oryza sativa subsp. japonica GN=CYCL1-1 PE=2 SV=1 76 393 4.0E-26
sp|O88874|CCNK_MOUSE Cyclin-K OS=Mus musculus GN=Ccnk PE=1 SV=3 76 358 5.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74627|CG1C_SCHPO Cyclin pch1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pch1 PE=1 SV=1 58 395 5.0E-52
sp|Q2RAC5|CCT13_ORYSJ Cyclin-T1-3 OS=Oryza sativa subsp. japonica GN=CYCT1-3 PE=3 SV=2 73 315 1.0E-26
sp|Q2QQS5|CCT14_ORYSJ Cyclin-T1-4 OS=Oryza sativa subsp. japonica GN=CYCT1-1 PE=2 SV=1 73 323 2.0E-26
sp|Q9AS36|CCL11_ORYSJ Cyclin-L1-1 OS=Oryza sativa subsp. japonica GN=CYCL1-1 PE=2 SV=1 76 393 4.0E-26
sp|O88874|CCNK_MOUSE Cyclin-K OS=Mus musculus GN=Ccnk PE=1 SV=3 76 358 5.0E-26
sp|Q9FKE6|CCT15_ARATH Cyclin-T1-5 OS=Arabidopsis thaliana GN=CYCT1-5 PE=1 SV=2 75 315 8.0E-25
sp|O75909|CCNK_HUMAN Cyclin-K OS=Homo sapiens GN=CCNK PE=1 SV=2 76 310 1.0E-24
sp|Q8GYM6|CCT14_ARATH Cyclin-T1-4 OS=Arabidopsis thaliana GN=CYCT1-4 PE=1 SV=1 75 315 7.0E-24
sp|Q6GN15|CCNL1_XENLA Cyclin-L1 OS=Xenopus laevis GN=ccnl1 PE=2 SV=2 46 299 1.0E-22
sp|Q5BKF8|CCNL2_XENTR Cyclin-L2 OS=Xenopus tropicalis GN=ccnl2 PE=2 SV=1 81 373 6.0E-22
sp|Q5I0H5|CCNL2_RAT Cyclin-L2 OS=Rattus norvegicus GN=Ccnl2 PE=1 SV=2 81 423 1.0E-21
sp|Q9JJA7|CCNL2_MOUSE Cyclin-L2 OS=Mus musculus GN=Ccnl2 PE=1 SV=1 81 423 2.0E-21
sp|Q7ZVX0|CCNL1_DANRE Cyclin-L1 OS=Danio rerio GN=ccnl1 PE=1 SV=1 52 320 3.0E-21
sp|Q8RWV3|CCL11_ARATH Cyclin-L1-1 OS=Arabidopsis thaliana GN=CYCL1-1 PE=1 SV=2 75 313 2.0E-20
sp|Q5ZJP9|CCNL1_CHICK Cyclin-L1 OS=Gallus gallus GN=CCNL1 PE=2 SV=1 86 368 4.0E-20
sp|Q9UK58|CCNL1_HUMAN Cyclin-L1 OS=Homo sapiens GN=CCNL1 PE=1 SV=1 68 275 4.0E-20
sp|Q52KE7|CCNL1_MOUSE Cyclin-L1 OS=Mus musculus GN=Ccnl1 PE=1 SV=1 77 275 4.0E-20
sp|Q9R1Q2|CCNL1_RAT Cyclin-L1 OS=Rattus norvegicus GN=Ccnl1 PE=1 SV=1 77 275 5.0E-20
sp|Q9QWV9|CCNT1_MOUSE Cyclin-T1 OS=Mus musculus GN=Ccnt1 PE=1 SV=3 76 296 8.0E-20
sp|Q9XT26|CCNT1_HORSE Cyclin-T1 OS=Equus caballus GN=CCNT1 PE=1 SV=1 76 314 1.0E-19
sp|O60563|CCNT1_HUMAN Cyclin-T1 OS=Homo sapiens GN=CCNT1 PE=1 SV=1 76 296 2.0E-19
sp|Q6T8E9|CCNT1_BOVIN Cyclin-T1 OS=Bos taurus GN=CCNT1 PE=1 SV=1 76 296 2.0E-19
sp|Q8HXN7|CCNT1_PANTR Cyclin-T1 OS=Pan troglodytes GN=CCNT1 PE=2 SV=1 71 296 2.0E-19
sp|Q6Z7H3|CCT12_ORYSJ Cyclin-T1-2 OS=Oryza sativa subsp. japonica GN=CYCT1_2 PE=2 SV=2 64 291 2.0E-18
sp|Q0E474|CCT11_ORYSJ Cyclin-T1-1 OS=Oryza sativa subsp. japonica GN=CYCT1-1 PE=3 SV=2 76 328 3.0E-18
sp|O60583|CCNT2_HUMAN Cyclin-T2 OS=Homo sapiens GN=CCNT2 PE=1 SV=2 76 295 6.0E-18
sp|Q56YF8|CCT12_ARATH Cyclin-T1-2 OS=Arabidopsis thaliana GN=CYCT1-2 PE=2 SV=2 62 259 1.0E-17
sp|Q96S94|CCNL2_HUMAN Cyclin-L2 OS=Homo sapiens GN=CCNL2 PE=1 SV=1 81 406 1.0E-15
sp|Q8N1B3|FA58A_HUMAN Cyclin-related protein FAM58A OS=Homo sapiens GN=FAM58A PE=1 SV=2 95 297 4.0E-15
sp|O96433|CCNT_DROME Cyclin-T OS=Drosophila melanogaster GN=CycT PE=1 SV=2 76 314 6.0E-15
sp|Q8QZR8|FA58B_MOUSE Cyclin-related protein FAM58B OS=Mus musculus GN=Fam58b PE=2 SV=2 95 297 2.0E-13
sp|Q8LBC0|CCT13_ARATH Cyclin-T1-3 OS=Arabidopsis thaliana GN=CYCT1-3 PE=1 SV=2 75 291 4.0E-13
sp|Q9C8P7|CCT11_ARATH Putative cyclin-T1-1 OS=Arabidopsis thaliana GN=CYCT1-1 PE=3 SV=1 76 315 3.0E-12
sp|Q4QQW5|FA58A_RAT Cyclin-related protein FAM58A OS=Rattus norvegicus GN=Fam58a PE=2 SV=1 108 297 4.0E-12
sp|Q6NRK9|FA58A_XENLA Cyclin-related protein FAM58A OS=Xenopus laevis GN=fam58a PE=2 SV=2 104 274 2.0E-11
sp|Q5RD50|CCNL1_PONAB Cyclin-L1 OS=Pongo abelii GN=CCNL1 PE=3 SV=1 68 173 2.0E-10
sp|Q9FJK6|CCC11_ARATH Cyclin-C1-1 OS=Arabidopsis thaliana GN=CYCC1-1 PE=2 SV=2 74 286 4.0E-10
sp|Q503D6|FA58A_DANRE Cyclin-related protein FAM58A OS=Danio rerio GN=fam58a PE=2 SV=1 108 247 2.0E-09
sp|P93411|CCC11_ORYSJ Cyclin-C1-1 OS=Oryza sativa subsp. japonica GN=Os09g0504400 PE=2 SV=1 92 282 3.0E-09
sp|Q9FJK7|CCC12_ARATH Cyclin-C1-2 OS=Arabidopsis thaliana GN=CYCC1-2 PE=2 SV=1 80 297 2.0E-08
sp|P34425|CCNT1_CAEEL Cyclin-T1.1 OS=Caenorhabditis elegans GN=cit-1.1 PE=3 SV=1 56 291 9.0E-08
sp|Q16JA2|CCNC_AEDAE Cyclin-C OS=Aedes aegypti GN=CycC PE=3 SV=1 107 300 2.0E-07
sp|Q7QB13|CCNC_ANOGA Cyclin-C OS=Anopheles gambiae GN=CycC PE=3 SV=2 107 300 6.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

Domain # Start End Length
1 108 130 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8150
MASIDRYRPPREGYQPPSLPGAVRNEQMSRSPPHRREVPPAAPTPPQHSARTSPPRSSAQPGQQSPTSSVRRGYQ
WSFTPEEVSSSPTIVHGVAPAEERLRRAKGVNFIYQAGVVLDLPQITLWVAGVFFHRFFMRKSMVEEKGGIHHYN
IAATALFLANKVEENCRKTKDIIIAVVKVAQKNAKLVIDEQSKEYWRWRDSILMYEESMLEHLTFDLMIDNPYRH
LFEILGQLDIVHNKNLRQAAWAFCNDACLTALPLLIEARDVAISAIFFASVHTSQQVDDIHGEPWWKYLNGDEER
CTRAIEVMRQFYTENPLRKQNPSLPSPPYDLENTRRRADALMSQPDALSSAGGTPMVDRASRSPAPKTNGTERGA
EAKERDAKTAPPPRGVEGADTVTRSTPKRREADVDMSSSQERAEKRTRLSEDEGEVEE
Coding >Ophio5|8150
ATGGCGAGCATCGACCGCTACCGGCCTCCTCGCGAAGGCTACCAGCCGCCGAGTCTTCCGGGAGCTGTTCGAAAC
GAGCAGATGTCGCGATCCCCTCCTCACCGGCGCGAGGTTCCGCCTGCTGCGCCGACTCCGCCCCAGCACAGCGCG
CGGACATCTCCGCCGCGATCCAGCGCCCAACCCGGCCAGCAGTCGCCCACGTCATCCGTTAGGCGAGGCTATCAG
TGGTCTTTTACGCCGGAGGAGGTCTCCAGTTCCCCGACCATCGTCCACGGCGTGGCCCCGGCCGAGGAGAGGCTG
CGCAGGGCCAAGGGCGTTAACTTCATCTACCAGGCCGGCGTCGTGCTCGACCTGCCGCAGATCACCCTATGGGTA
GCCGGCGTTTTCTTCCACAGGTTCTTCATGCGTAAGAGCATGGTTGAGGAAAAGGGCGGCATTCATCACTACAAC
ATCGCCGCCACCGCGCTTTTCCTTGCAAATAAGGTCGAGGAGAACTGCCGAAAAACCAAAGACATCATCATCGCG
GTGGTCAAGGTCGCACAGAAAAACGCCAAGCTCGTCATCGATGAGCAGAGCAAGGAGTATTGGCGATGGAGGGAC
AGCATCCTCATGTACGAAGAGAGCATGCTGGAGCACCTCACCTTTGACCTCATGATAGATAACCCCTATCGACAT
CTCTTTGAGATCCTCGGACAGCTCGACATTGTTCACAATAAGAACTTGAGACAGGCTGCATGGGCATTCTGCAAC
GACGCGTGCCTCACGGCGTTGCCACTGCTCATCGAGGCAAGGGACGTCGCCATCAGTGCCATCTTCTTCGCCAGC
GTTCATACGAGCCAACAGGTCGACGACATCCACGGCGAACCGTGGTGGAAGTACCTCAACGGGGACGAGGAGCGC
TGCACGAGGGCCATCGAGGTTATGCGCCAATTCTACACTGAGAATCCACTCAGAAAGCAGAATCCATCGCTGCCA
TCACCTCCCTACGACCTGGAGAACACGAGACGGAGGGCGGACGCGCTCATGAGCCAGCCGGACGCGCTGTCGTCG
GCGGGAGGGACACCCATGGTCGATCGAGCCAGCCGCAGCCCGGCGCCCAAGACTAACGGCACCGAAAGGGGCGCC
GAAGCCAAGGAGCGGGATGCGAAAACGGCACCACCGCCCCGTGGGGTGGAAGGTGCCGATACCGTTACGAGATCA
ACGCCGAAGAGGAGAGAGGCAGATGTGGACATGAGCTCCAGCCAGGAGCGAGCTGAGAAACGAACCAGGCTGTCG
GAGGACGAAGGCGAGGTAGAGGAG
Transcript >Ophio5|8150
ATGGCGAGCATCGACCGCTACCGGCCTCCTCGCGAAGGCTACCAGCCGCCGAGTCTTCCGGGAGCTGTTCGAAAC
GAGCAGATGTCGCGATCCCCTCCTCACCGGCGCGAGGTTCCGCCTGCTGCGCCGACTCCGCCCCAGCACAGCGCG
CGGACATCTCCGCCGCGATCCAGCGCCCAACCCGGCCAGCAGTCGCCCACGTCATCCGTTAGGCGAGGCTATCAG
TGGTCTTTTACGCCGGAGGAGGTCTCCAGTTCCCCGACCATCGTCCACGGCGTGGCCCCGGCCGAGGAGAGGCTG
CGCAGGGCCAAGGGCGTTAACTTCATCTACCAGGCCGGCGTCGTGCTCGACCTGCCGCAGATCACCCTATGGGTA
GCCGGCGTTTTCTTCCACAGGTTCTTCATGCGTAAGAGCATGGTTGAGGAAAAGGGCGGCATTCATCACTACAAC
ATCGCCGCCACCGCGCTTTTCCTTGCAAATAAGGTCGAGGAGAACTGCCGAAAAACCAAAGACATCATCATCGCG
GTGGTCAAGGTCGCACAGAAAAACGCCAAGCTCGTCATCGATGAGCAGAGCAAGGAGTATTGGCGATGGAGGGAC
AGCATCCTCATGTACGAAGAGAGCATGCTGGAGCACCTCACCTTTGACCTCATGATAGATAACCCCTATCGACAT
CTCTTTGAGATCCTCGGACAGCTCGACATTGTTCACAATAAGAACTTGAGACAGGCTGCATGGGCATTCTGCAAC
GACGCGTGCCTCACGGCGTTGCCACTGCTCATCGAGGCAAGGGACGTCGCCATCAGTGCCATCTTCTTCGCCAGC
GTTCATACGAGCCAACAGGTCGACGACATCCACGGCGAACCGTGGTGGAAGTACCTCAACGGGGACGAGGAGCGC
TGCACGAGGGCCATCGAGGTTATGCGCCAATTCTACACTGAGAATCCACTCAGAAAGCAGAATCCATCGCTGCCA
TCACCTCCCTACGACCTGGAGAACACGAGACGGAGGGCGGACGCGCTCATGAGCCAGCCGGACGCGCTGTCGTCG
GCGGGAGGGACACCCATGGTCGATCGAGCCAGCCGCAGCCCGGCGCCCAAGACTAACGGCACCGAAAGGGGCGCC
GAAGCCAAGGAGCGGGATGCGAAAACGGCACCACCGCCCCGTGGGGTGGAAGGTGCCGATACCGTTACGAGATCA
ACGCCGAAGAGGAGAGAGGCAGATGTGGACATGAGCTCCAGCCAGGAGCGAGCTGAGAAACGAACCAGGCTGTCG
GAGGACGAAGGCGAGGTAGAGGAGTGA
Gene >Ophio5|8150
ATGGCGAGCATCGACCGCTACCGGCCTCCTCGCGAAGGCTACCAGCCGCCGAGTCTTCCGGGAGCTGTTCGAAAC
GAGCAGATGTCGCGATCCCCTCCTCACCGGCGCGAGGTTCCGCCTGCTGCGCCGACTCCGCCCCAGCACAGCGCG
CGGACATCTCCGCCGCGATCCAGCGCCCAACCCGGCCAGCAGTCGCCCACGTCATCCGTTAGGCGAGGCTATCAG
TGGTCTTTTACGCCGGAGGAGGTCTCCAGTTCCCCGACCATCGTCCACGGCGTGGCCCCGGCCGAGGAGAGGCTG
CGCAGGGCCAAGGGCGTTAACTTCATCTACCAGGCCGGCGTCGTGCTCGACCTGCCGCAGATCACCCTATGGGTA
GCCGGCGTTTTCTTCCACAGGTTCTTCATGCGTAAGAGCATGGTTGAGGAAAAGGGCGGCATTCATCACTACGTG
AGCATTCCTTTTCGTCGGCGCGGAGATGTCACCGTCTCTCCCGGCCTCCTTCCCTTCCGCCGAAGAATGGCTGAC
GACGTTGTAGAACATCGCCGCCACCGCGCTTTTCCTTGCAAATAAGGTCGAGGAGAACTGCCGAAAAACCAAAGA
CATCATCATCGCGGTGGTCAAGGTCGCACAGAAAAACGCCAAGCTCGTCATCGATGAGCAGAGCAAGGAGTATTG
GCGATGGAGGGACAGCATCCTCATGTACGAAGAGAGCATGCTGGAGCACCTCACCTTTGACCTCATGATAGATAA
CCCCTATCGACATCTCTTTGAGATCCTCGGACAGCTCGACATTGTTCACAATAAGAACTTGAGACAGGCTGCATG
GGCATTCTGCAACGACGCGTGCCTCACGGCGTTGCCACTGCTCATCGAGGCAAGGGACGTCGCCATCAGTGCCAT
CTTCTTCGCCAGCGTTCATACGAGCCAACAGGTCGACGACATCCACGGCGAACCGTGGTGGAAGTACCTCAACGG
GGACGAGGAGCGCTGCACGAGGGCCATCGAGGTTATGCGCCAATTCTACACTGAGAATCCACTCAGAAAGCAGAA
TCCATCGCTGCCATCACCTCCCTACGACCTGGAGAACACGAGACGGAGGGCGGACGCGCTCATGAGCCAGCCGGA
CGCGCTGTCGTCGGCGGGAGGGACACCCATGGTCGATCGAGCCAGCCGCAGCCCGGCGCCCAAGACTAACGGCAC
CGAAAGGGGCGCCGAAGCCAAGGAGCGGGATGCGAAAACGGCACCACCGCCCCGTGGGGTGGAAGGTGCCGATAC
CGTTACGAGATCAACGCCGAAGAGGAGAGAGGCAGATGTGGACATGAGCTCCAGCCAGGAGCGAGCTGAGAAACG
AACCAGGCTGTCGGAGGACGAAGGCGAGGTAGAGGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail