Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8122
Gene name
Locationscaffold_864:2166..3009
Strand-
Gene length (bp)843
Transcript length (bp)729
Coding sequence length (bp)726
Protein length (aa) 242

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06916 FAM210A-B_dom FAM210A/B-like domain 1.2E-25 89 225

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9URV4|YBL7_SCHPO Uncharacterized protein C106.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC106.07c PE=4 SV=1 83 231 5.0E-21
sp|P37293|NAT2_YEAST N-terminal acetyltransferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAT2 PE=1 SV=2 90 242 1.0E-17

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 98 120 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 123.54 67.73 179.35
CcL In ants, during behavior modification 137.44 68.83 206.06
CcD In ants, recently dead 99.70 53.78 145.62

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.699859 no
SC16a CcD 0.375439 no
CcL CcD 0.192536 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8122
MFRLSAFPLARWRSRQSVAVQGVWRKLFSLETRMAANGSRQWQRSTMRHDAKRTRPTLYLQRRAFNLSPWRRTAG
DGGKAPERLSLGARLKKLSKEYGWSAIGVYLALSVLDFPLCFLLVKIVGTEKIGKMEHYVVSTLSSIVPDSMRQR
WREYRQAVADARQQQQPQQPGSDGGAAMVVTWGVQEAQRSNDEEASLATQLALAYAIHKSFIFIRVPLTAAVTPK
VVKMLRSWGWNIGKRRR
Coding >Ophio5|8122
ATGTTTCGACTATCCGCCTTTCCTCTCGCCAGATGGAGGAGCCGGCAATCGGTCGCCGTACAGGGCGTCTGGAGG
AAGCTCTTCAGCCTCGAGACGAGGATGGCGGCCAACGGATCGAGGCAATGGCAGAGGTCGACGATGCGCCATGAT
GCGAAGCGGACGAGACCGACCTTGTACCTGCAGCGACGGGCCTTCAACCTGTCCCCCTGGAGACGCACTGCCGGT
GACGGGGGCAAGGCTCCGGAGAGGCTGTCGCTGGGCGCGAGGCTAAAGAAGCTCTCCAAGGAATACGGCTGGTCG
GCGATAGGCGTCTACCTGGCCCTCAGTGTCCTAGACTTTCCCTTGTGCTTTCTCCTCGTCAAGATAGTCGGGACG
GAGAAGATTGGCAAAATGGAGCACTACGTCGTCTCTACCCTGTCGAGCATAGTCCCCGATTCGATGAGGCAGCGA
TGGCGCGAGTATCGGCAGGCCGTGGCCGATGCTCGGCAGCAGCAGCAGCCGCAGCAGCCGGGCAGCGACGGCGGG
GCAGCAATGGTGGTGACCTGGGGGGTGCAAGAGGCGCAACGAAGCAACGACGAGGAAGCCAGCCTGGCGACGCAA
CTGGCACTCGCCTACGCCATCCACAAGAGCTTCATCTTCATCCGGGTGCCACTGACGGCGGCGGTGACGCCCAAA
GTCGTCAAGATGCTCAGATCTTGGGGTTGGAACATTGGCAAGCGACGGCGG
Transcript >Ophio5|8122
ATGTTTCGACTATCCGCCTTTCCTCTCGCCAGATGGAGGAGCCGGCAATCGGTCGCCGTACAGGGCGTCTGGAGG
AAGCTCTTCAGCCTCGAGACGAGGATGGCGGCCAACGGATCGAGGCAATGGCAGAGGTCGACGATGCGCCATGAT
GCGAAGCGGACGAGACCGACCTTGTACCTGCAGCGACGGGCCTTCAACCTGTCCCCCTGGAGACGCACTGCCGGT
GACGGGGGCAAGGCTCCGGAGAGGCTGTCGCTGGGCGCGAGGCTAAAGAAGCTCTCCAAGGAATACGGCTGGTCG
GCGATAGGCGTCTACCTGGCCCTCAGTGTCCTAGACTTTCCCTTGTGCTTTCTCCTCGTCAAGATAGTCGGGACG
GAGAAGATTGGCAAAATGGAGCACTACGTCGTCTCTACCCTGTCGAGCATAGTCCCCGATTCGATGAGGCAGCGA
TGGCGCGAGTATCGGCAGGCCGTGGCCGATGCTCGGCAGCAGCAGCAGCCGCAGCAGCCGGGCAGCGACGGCGGG
GCAGCAATGGTGGTGACCTGGGGGGTGCAAGAGGCGCAACGAAGCAACGACGAGGAAGCCAGCCTGGCGACGCAA
CTGGCACTCGCCTACGCCATCCACAAGAGCTTCATCTTCATCCGGGTGCCACTGACGGCGGCGGTGACGCCCAAA
GTCGTCAAGATGCTCAGATCTTGGGGTTGGAACATTGGCAAGCGACGGCGGTGA
Gene >Ophio5|8122
ATGTTTCGACTATCCGCCTTTCCTCTCGCCAGATGGAGGAGCCGGCAATCGGTCGCCGTACAGGGCGTCTGGAGG
AAGCTCTTCAGCCTCGAGACGAGGATGGCGGCCAACGGATCGAGGCAATGGCAGAGGTCGACGATGCGCCATGAT
GCGAAGCGGACGAGACCGACCTTGTACCTGCAGCGACGGGCCTTCAACCTGTCCCCCTGGAGACGCACTGCCGGT
GACGGGGGCAAGGCTCCGGAGAGGCTGTCGCTGGGCGCGAGGCTAAAGAAGCTCTCCAAGGAATACGGCTGGTCG
GCGATAGGCGTCTACCTGGCCCTCAGTGTCCTAGACTTTCCCTTGTGCTTTCTCCTCGTCAAGATAGTCGGGACG
GAGAAGATTGGTGAGTGTCGGTCGTCCTACTCTCTTGCTTGGCTGGCCGCTTACACGACGATGCCGACAAAAGGC
AAAATGGAGCACTACGTCGTCTCTACCCTGTCGAGCATAGTCCCCGATTCGATGAGGCAGCGATGGCGCGAGTAT
CGGCAGGCCGTGGCCGATGCTCGGCAGCAGCAGCAGCCGCAGCAGCCGGGCAGCGACGGCGGGGCAGCAATGGTG
GTGACCTGGGGGGTGCAAGAGGCGCAACGAAGCAACGACGAGGAAGCCAGTAGGTTTTACGCAGGGTCGTCGCAA
GACGAGACGCTGACCAAGCGCCCAGGCCTGGCGACGCAACTGGCACTCGCCTACGCCATCCACAAGAGCTTCATC
TTCATCCGGGTGCCACTGACGGCGGCGGTGACGCCCAAAGTCGTCAAGATGCTCAGATCTTGGGGTTGGAACATT
GGCAAGCGACGGCGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail