Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8118
Gene name
Locationscaffold_862:4371..5614
Strand+
Gene length (bp)1243
Transcript length (bp)1023
Coding sequence length (bp)1020
Protein length (aa) 340

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00230 MIP Major intrinsic protein 1.2E-50 54 292

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8R2N1|AQP3_MOUSE Aquaporin-3 OS=Mus musculus GN=Aqp3 PE=1 SV=1 54 296 5.0E-58
sp|P43549|YFF4_YEAST Uncharacterized membrane protein YFL054C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YFL054C PE=1 SV=1 45 306 6.0E-58
sp|Q08DE6|AQP3_BOVIN Aquaporin-3 OS=Bos taurus GN=AQP3 PE=2 SV=1 54 296 9.0E-58
sp|Q92482|AQP3_HUMAN Aquaporin-3 OS=Homo sapiens GN=AQP3 PE=2 SV=2 54 296 1.0E-57
sp|A9Y006|AQP3_PIG Aquaporin-3 OS=Sus scrofa GN=AQP3 PE=2 SV=1 54 296 2.0E-57
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8R2N1|AQP3_MOUSE Aquaporin-3 OS=Mus musculus GN=Aqp3 PE=1 SV=1 54 296 5.0E-58
sp|P43549|YFF4_YEAST Uncharacterized membrane protein YFL054C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YFL054C PE=1 SV=1 45 306 6.0E-58
sp|Q08DE6|AQP3_BOVIN Aquaporin-3 OS=Bos taurus GN=AQP3 PE=2 SV=1 54 296 9.0E-58
sp|Q92482|AQP3_HUMAN Aquaporin-3 OS=Homo sapiens GN=AQP3 PE=2 SV=2 54 296 1.0E-57
sp|A9Y006|AQP3_PIG Aquaporin-3 OS=Sus scrofa GN=AQP3 PE=2 SV=1 54 296 2.0E-57
sp|P47862|AQP3_RAT Aquaporin-3 OS=Rattus norvegicus GN=Aqp3 PE=2 SV=1 54 296 4.0E-57
sp|P23900|FPS1_YEAST Glycerol uptake/efflux facilitator protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FPS1 PE=1 SV=2 2 304 2.0E-56
sp|O43315|AQP9_HUMAN Aquaporin-9 OS=Homo sapiens GN=AQP9 PE=2 SV=2 54 332 5.0E-54
sp|Q4R691|AQP7_MACFA Aquaporin-7 OS=Macaca fascicularis GN=AQP7 PE=2 SV=1 54 296 5.0E-53
sp|O14520|AQP7_HUMAN Aquaporin-7 OS=Homo sapiens GN=AQP7 PE=1 SV=1 50 296 1.0E-52
sp|P56627|AQP9_RAT Aquaporin-9 OS=Rattus norvegicus GN=Aqp9 PE=2 SV=1 54 304 8.0E-50
sp|A6NL99|AQP73_HUMAN Putative aquaporin-7-like protein 3 OS=Homo sapiens GN=AQP7P3 PE=5 SV=2 50 296 1.0E-49
sp|Q9P7T9|YI7H_SCHPO Uncharacterized membrane protein C977.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC977.17 PE=3 SV=1 46 306 4.0E-49
sp|Q96PS8|AQP10_HUMAN Aquaporin-10 OS=Homo sapiens GN=AQP10 PE=2 SV=2 48 296 6.0E-49
sp|P56403|AQP7_RAT Aquaporin-7 OS=Rattus norvegicus GN=Aqp7 PE=1 SV=2 50 305 1.0E-48
sp|O54794|AQP7_MOUSE Aquaporin-7 OS=Mus musculus GN=Aqp7 PE=1 SV=1 54 336 4.0E-47
sp|Q9JJJ3|AQP9_MOUSE Aquaporin-9 OS=Mus musculus GN=Aqp9 PE=2 SV=1 54 340 2.0E-46
sp|Q51389|GLPF_PSEAE Glycerol uptake facilitator protein OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=glpF PE=3 SV=2 55 296 5.0E-42
sp|P44826|GLPF_HAEIN Glycerol uptake facilitator protein OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=glpF PE=3 SV=1 50 304 4.0E-39
sp|P37451|PDUF_SALTY Propanediol diffusion facilitator OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=pduF PE=2 SV=2 58 296 2.0E-36
sp|P31140|GLPF_SHIFL Glycerol uptake facilitator protein OS=Shigella flexneri GN=glpF PE=3 SV=2 55 296 5.0E-34
sp|Q9X1E3|GLPF_THEMA Probable glycerol uptake facilitator protein OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=glpF PE=3 SV=1 57 293 7.0E-34
sp|P0AER0|GLPF_ECOLI Glycerol uptake facilitator protein OS=Escherichia coli (strain K12) GN=glpF PE=1 SV=1 55 296 1.0E-33
sp|P0AER1|GLPF_ECOL6 Glycerol uptake facilitator protein OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=glpF PE=3 SV=1 55 296 1.0E-33
sp|P0AER2|GLPF_ECO57 Glycerol uptake facilitator protein OS=Escherichia coli O157:H7 GN=glpF PE=3 SV=1 55 296 1.0E-33
sp|P18156|GLPF_BACSU Glycerol uptake facilitator protein OS=Bacillus subtilis (strain 168) GN=glpF PE=2 SV=2 59 293 4.0E-30
sp|P19255|GLPF_STRCO Probable glycerol uptake facilitator protein OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=glpF PE=2 SV=2 57 294 8.0E-30
sp|P0A3Q8|GLPF_STRR6 Glycerol uptake facilitator protein OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=glpF PE=3 SV=1 54 295 1.0E-23
sp|P22094|GLA_LACLC Glycerol facilitator-aquaporin gla OS=Lactococcus lactis subsp. cremoris GN=gla PE=1 SV=1 52 294 2.0E-23
sp|Q9CE02|GLA_LACLA Glycerol facilitator-aquaporin gla OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=gla PE=3 SV=1 52 294 5.0E-23
sp|P0A3Q7|GLPF_STRPN Glycerol uptake facilitator protein OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=glpF PE=3 SV=1 54 295 9.0E-23
sp|Q9FIZ9|NIP41_ARATH Putative aquaporin NIP4-1 OS=Arabidopsis thaliana GN=NIP4-1 PE=3 SV=1 47 300 8.0E-20
sp|P47279|GLPF_MYCGE Probable glycerol uptake facilitator protein OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=glpF PE=3 SV=2 57 303 2.0E-19
sp|P57392|GLPF_BUCAI Glycerol uptake facilitator protein OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=glpF PE=3 SV=1 48 296 2.0E-17
sp|Q8K9M9|GLPF_BUCAP Glycerol uptake facilitator protein OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=glpF PE=3 SV=1 54 296 6.0E-17
sp|Q9SAI4|NIP61_ARATH Aquaporin NIP6-1 OS=Arabidopsis thaliana GN=NIP6-1 PE=1 SV=1 39 294 6.0E-16
sp|Q8W036|NIP42_ARATH Probable aquaporin NIP4-2 OS=Arabidopsis thaliana GN=NIP4-2 PE=2 SV=2 47 300 7.0E-16
sp|Q40746|NIP11_ORYSJ Aquaporin NIP1-1 OS=Oryza sativa subsp. japonica GN=NIP1-1 PE=2 SV=1 54 300 2.0E-15
sp|Q8LAI1|NIP71_ARATH Probable aquaporin NIP7-1 OS=Arabidopsis thaliana GN=NIP7-1 PE=2 SV=2 54 292 2.0E-14
sp|Q9ATN1|NIP31_MAIZE Aquaporin NIP3-1 OS=Zea mays GN=NIP3-1 PE=2 SV=1 54 302 5.0E-14
sp|Q7Y1E6|PIP28_ORYSJ Probable aquaporin PIP2-8 OS=Oryza sativa subsp. japonica GN=PIP2-8 PE=2 SV=1 24 299 1.0E-13
sp|Q0IWF3|NIP31_ORYSJ Aquaporin NIP3-1 OS=Oryza sativa subsp. japonica GN=NIP3-1 PE=2 SV=2 54 302 1.0E-13
sp|Q7EYH7|NIP32_ORYSJ Aquaporin NIP3-2 OS=Oryza sativa subsp. japonica GN=NIP3-2 PE=2 SV=1 22 292 2.0E-13
sp|P75071|GLPF_MYCPN Probable glycerol uptake facilitator protein OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=glpF PE=3 SV=1 58 296 4.0E-13
sp|Q9ATM4|PIP27_MAIZE Aquaporin PIP2-7 OS=Zea mays GN=PIP2-7 PE=2 SV=1 14 301 5.0E-13
sp|P55088|AQP4_MOUSE Aquaporin-4 OS=Mus musculus GN=Aqp4 PE=1 SV=2 50 293 8.0E-13
sp|Q8GRT8|PIP24_ORYSJ Aquaporin PIP2-4 OS=Oryza sativa subsp. japonica GN=PIP2-4 PE=2 SV=1 10 284 9.0E-13
sp|Q9ATN2|NIP22_MAIZE Aquaporin NIP2-2 OS=Zea mays GN=NIP2-2 PE=2 SV=1 53 302 1.0E-12
sp|Q9SV84|NIP51_ARATH Probable aquaporin NIP5-1 OS=Arabidopsis thaliana GN=NIP5-1 PE=2 SV=1 24 292 1.0E-12
sp|Q9FF53|PIP24_ARATH Probable aquaporin PIP2-4 OS=Arabidopsis thaliana GN=PIP2-4 PE=1 SV=1 6 296 1.0E-12
sp|P42767|PIP1_ATRCA Aquaporin PIP-type OS=Atriplex canescens PE=2 SV=1 20 293 2.0E-12
sp|Q19KC1|NIP21_MAIZE Aquaporin NIP2-1 OS=Zea mays GN=NIP2-1 PE=2 SV=2 54 302 2.0E-12
sp|Q8GRI8|PIP25_ORYSJ Aquaporin PIP2-5 OS=Oryza sativa subsp. japonica GN=PIP2-5 PE=2 SV=1 23 284 2.0E-12
sp|Q651D5|PIP27_ORYSJ Probable aquaporin PIP2-7 OS=Oryza sativa subsp. japonica GN=PIP2-7 PE=2 SV=2 27 301 2.0E-12
sp|P25794|PIP2_PEA Probable aquaporin PIP-type 7a OS=Pisum sativum GN=TRG-31 PE=2 SV=2 20 296 5.0E-12
sp|Q9C6T0|NIP31_ARATH Aquaporin NIP3-1 OS=Arabidopsis thaliana GN=NIP3-1 PE=2 SV=2 59 301 6.0E-12
sp|Q9ATN4|NIP11_MAIZE Aquaporin NIP1-1 OS=Zea mays GN=NIP1-1 PE=2 SV=1 54 267 6.0E-12
sp|Q0JPT5|NIP12_ORYSJ Aquaporin NIP1-2 OS=Oryza sativa subsp. japonica GN=NIP1-2 PE=2 SV=2 57 300 8.0E-12
sp|Q923J4|AQP4_DIPME Aquaporin-4 OS=Dipodomys merriami GN=AQP4 PE=2 SV=1 50 293 1.0E-11
sp|Q6Z2T3|NIP21_ORYSJ Aquaporin NIP2-1 OS=Oryza sativa subsp. japonica GN=NIP2-1 PE=1 SV=1 54 302 1.0E-11
sp|Q8VZW1|NIP11_ARATH Aquaporin NIP1-1 OS=Arabidopsis thaliana GN=NIP1-1 PE=1 SV=1 20 300 1.0E-11
sp|Q5I4F9|AQP4_NOTAL Aquaporin-4 OS=Notomys alexis GN=AQP4 PE=2 SV=1 50 293 2.0E-11
sp|P47863|AQP4_RAT Aquaporin-4 OS=Rattus norvegicus GN=Aqp4 PE=1 SV=1 50 293 2.0E-11
sp|Q9AT74|NIP23_MAIZE Aquaporin NIP2-3 OS=Zea mays GN=NIP2-3 PE=2 SV=1 53 302 2.0E-11
sp|Q9ZVX8|PIP28_ARATH Probable aquaporin PIP2-8 OS=Arabidopsis thaliana GN=PIP2-8 PE=1 SV=1 20 296 2.0E-11
sp|P43287|PIP22_ARATH Aquaporin PIP2-2 OS=Arabidopsis thaliana GN=PIP2-2 PE=1 SV=2 21 296 3.0E-11
sp|Q9AR14|PIP15_MAIZE Aquaporin PIP1-5 OS=Zea mays GN=PIP1-5 PE=2 SV=1 5 296 4.0E-11
sp|P08995|NO26_SOYBN Nodulin-26 OS=Glycine max PE=1 SV=2 58 300 5.0E-11
sp|Q6EU94|PIP11_ORYSJ Aquaporin PIP1-1 OS=Oryza sativa subsp. japonica GN=PIP1-1 PE=2 SV=1 5 296 6.0E-11
sp|P49173|NIP1_NICAL Probable aquaporin NIP-type OS=Nicotiana alata PE=2 SV=1 54 304 6.0E-11
sp|Q7XSQ9|PIP12_ORYSJ Probable aquaporin PIP1-2 OS=Oryza sativa subsp. japonica GN=PIP1-2 PE=2 SV=3 5 296 6.0E-11
sp|Q9XF59|PIP12_MAIZE Aquaporin PIP1-2 OS=Zea mays GN=PIP1-2 PE=1 SV=1 5 296 7.0E-11
sp|P93004|PIP27_ARATH Aquaporin PIP2-7 OS=Arabidopsis thaliana GN=PIP2-7 PE=1 SV=2 20 296 9.0E-11
sp|P55087|AQP4_HUMAN Aquaporin-4 OS=Homo sapiens GN=AQP4 PE=1 SV=2 50 293 9.0E-11
sp|Q9C4Z5|AQPM_METTM Aquaporin AqpM OS=Methanothermobacter marburgensis (strain DSM 2133 / 14651 / NBRC 100331 / OCM 82 / Marburg) GN=aqpM PE=1 SV=4 54 287 1.0E-10
sp|Q9SXF8|PIP13_ORYSJ Aquaporin PIP 1-3 OS=Oryza sativa subsp. japonica GN=PIP1-3 PE=2 SV=2 5 284 1.0E-10
sp|Q8W037|NIP21_ARATH Aquaporin NIP2-1 OS=Arabidopsis thaliana GN=NIP2-1 PE=2 SV=2 11 295 2.0E-10
sp|Q41870|PIP11_MAIZE Aquaporin PIP1-1 OS=Zea mays GN=PIP1-1 PE=1 SV=1 15 296 2.0E-10
sp|Q9ATM5|PIP26_MAIZE Aquaporin PIP2-6 OS=Zea mays GN=PIP2-6 PE=2 SV=1 21 284 2.0E-10
sp|Q0DK16|NIP13_ORYSJ Aquaporin NIP1-3 OS=Oryza sativa subsp. japonica GN=NIP1-3 PE=3 SV=2 52 300 2.0E-10
sp|P52280|GLPF_MYCGA Probable glycerol uptake facilitator protein OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=glpF PE=3 SV=2 59 289 3.0E-10
sp|P30302|PIP23_ARATH Aquaporin PIP2-3 OS=Arabidopsis thaliana GN=PIP2-3 PE=1 SV=1 21 296 4.0E-10
sp|Q8LFP7|NIP12_ARATH Aquaporin NIP1-2 OS=Arabidopsis thaliana GN=NIP1-2 PE=2 SV=2 36 300 4.0E-10
sp|P34080|AQP2_RAT Aquaporin-2 OS=Rattus norvegicus GN=Aqp2 PE=1 SV=1 48 330 5.0E-10
sp|P43286|PIP21_ARATH Aquaporin PIP2-1 OS=Arabidopsis thaliana GN=PIP2-1 PE=1 SV=1 21 296 5.0E-10
sp|P56402|AQP2_MOUSE Aquaporin-2 OS=Mus musculus GN=Aqp2 PE=1 SV=2 48 330 6.0E-10
sp|Q9AQU5|PIP13_MAIZE Aquaporin PIP1-3/PIP1-4 OS=Zea mays GN=PIP1-3 PE=2 SV=1 23 296 6.0E-10
sp|O77750|AQP4_BOVIN Aquaporin-4 OS=Bos taurus GN=AQP4 PE=2 SV=3 86 293 7.0E-10
sp|Q866S3|AQP5_SHEEP Aquaporin-5 OS=Ovis aries GN=AQP5 PE=2 SV=1 51 330 1.0E-09
sp|Q9XF58|PIP25_MAIZE Aquaporin PIP2-5 OS=Zea mays GN=PIP2-5 PE=1 SV=1 14 305 1.0E-09
sp|Q84S07|NIP33_ORYSJ Aquaporin NIP3-3 OS=Oryza sativa subsp. japonica GN=NIP3-3 PE=2 SV=1 54 292 1.0E-09
sp|O28846|AQPM_ARCFU Probable aquaporin AqpM OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=aqpM PE=1 SV=1 58 293 1.0E-09
sp|Q67WJ8|NIP22_ORYSJ Aquaporin NIP2-2 OS=Oryza sativa subsp. japonica GN=NIP2-2 PE=2 SV=1 54 293 2.0E-09
sp|P55064|AQP5_HUMAN Aquaporin-5 OS=Homo sapiens GN=AQP5 PE=1 SV=1 51 333 2.0E-09
sp|Q9ATN0|PIP16_MAIZE Aquaporin PIP1-6 OS=Zea mays GN=PIP1-6 PE=2 SV=1 10 256 2.0E-09
sp|Q39196|PIP14_ARATH Probable aquaporin PIP1-4 OS=Arabidopsis thaliana GN=PIP1.4 PE=1 SV=1 5 296 3.0E-09
sp|Q7XLR1|PIP26_ORYSJ Probable aquaporin PIP2-6 OS=Oryza sativa subsp. japonica GN=PIP2-6 PE=2 SV=2 16 296 3.0E-09
sp|Q08451|PIP1_SOLLC Probable aquaporin PIP-type pTOM75 OS=Solanum lycopersicum PE=2 SV=1 5 286 4.0E-09
sp|Q9WTY4|AQP5_MOUSE Aquaporin-5 OS=Mus musculus GN=Aqp5 PE=1 SV=1 51 332 5.0E-09
sp|O86231|Y1017_HAEIN Uncharacterized aquaporin-like protein HI_1017 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1017 PE=3 SV=1 108 293 7.0E-09
sp|Q9ASI1|NIP41_ORYSJ Aquaporin NIP4-1 OS=Oryza sativa subsp. japonica GN=NIP4-1 PE=2 SV=1 111 288 1.0E-08
sp|P47864|AQP5_RAT Aquaporin-5 OS=Rattus norvegicus GN=Aqp5 PE=2 SV=1 51 332 2.0E-08
sp|Q06611|PIP12_ARATH Aquaporin PIP1-2 OS=Arabidopsis thaliana GN=PIP1-2 PE=1 SV=1 5 296 3.0E-08
sp|O26206|AQPM_METTH Aquaporin AqpM OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=aqpM PE=3 SV=1 54 293 4.0E-08
sp|Q6K215|PIP22_ORYSJ Probable aquaporin PIP2-2 OS=Oryza sativa subsp. japonica GN=PIP2-2 PE=2 SV=1 23 305 5.0E-08
sp|Q9V5Z7|AQP_DROME Aquaporin OS=Drosophila melanogaster GN=Drip PE=2 SV=2 50 322 8.0E-08
sp|Q9ZV07|PIP26_ARATH Probable aquaporin PIP2-6 OS=Arabidopsis thaliana GN=PIP2-6 PE=1 SV=1 32 296 1.0E-07
sp|Q7PWV1|AQP_ANOGA Aquaporin AQPAn.G OS=Anopheles gambiae GN=AGAP008842 PE=3 SV=4 54 305 1.0E-07
sp|Q8H5N9|PIP21_ORYSJ Probable aquaporin PIP2-1 OS=Oryza sativa subsp. japonica GN=PIP2-1 PE=2 SV=1 90 284 1.0E-07
sp|Q7XUA6|PIP23_ORYSJ Probable aquaporin PIP2-3 OS=Oryza sativa subsp. japonica GN=PIP2-3 PE=2 SV=1 24 305 2.0E-07
sp|Q9ATM6|PIP24_MAIZE Aquaporin PIP2-4 OS=Zea mays GN=PIP2-4 PE=1 SV=1 23 305 3.0E-07
sp|Q8LAA6|PIP15_ARATH Probable aquaporin PIP1-5 OS=Arabidopsis thaliana GN=PIP1-5 PE=2 SV=2 48 296 3.0E-07
sp|Q9SV31|PIP25_ARATH Probable aquaporin PIP2-5 OS=Arabidopsis thaliana GN=PIP2-5 PE=1 SV=1 23 296 3.0E-07
sp|Q7W917|AQPZ_BORPA Aquaporin Z OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=aqpZ PE=3 SV=1 58 294 3.0E-07
sp|Q7WKG2|AQPZ_BORBR Aquaporin Z OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=aqpZ PE=3 SV=1 58 294 3.0E-07
sp|A2IBY8|MIP_CANLF Lens fiber major intrinsic protein OS=Canis lupus familiaris GN=MIP PE=2 SV=1 48 320 3.0E-07
sp|Q9ATM8|PIP22_MAIZE Aquaporin PIP2-2 OS=Zea mays GN=PIP2-2 PE=2 SV=1 90 256 3.0E-07
sp|Q08733|PIP13_ARATH Aquaporin PIP1-3 OS=Arabidopsis thaliana GN=PIP1-3 PE=1 SV=1 54 296 4.0E-07
sp|Q84RL7|PIP21_MAIZE Aquaporin PIP2-1 OS=Zea mays GN=PIP2-1 PE=1 SV=2 90 256 4.0E-07
sp|Q9ATM7|PIP23_MAIZE Aquaporin PIP2-3 OS=Zea mays GN=PIP2-3 PE=2 SV=1 23 305 6.0E-07
sp|O62735|AQP2_SHEEP Aquaporin-2 OS=Ovis aries GN=AQP2 PE=2 SV=1 48 297 7.0E-07
sp|P79213|AQP2_RABIT Aquaporin-2 (Fragment) OS=Oryctolagus cuniculus GN=AQP2 PE=3 SV=1 51 150 9.0E-07
sp|P79099|AQP2_BOVIN Aquaporin-2 OS=Bos taurus GN=AQP2 PE=2 SV=2 48 297 9.0E-07
sp|A8W649|AQP5_PIG Aquaporin-5 OS=Sus scrofa GN=AQP5 PE=2 SV=1 51 297 9.0E-07
sp|P79803|AQP2_MACPR Aquaporin-2 (Fragment) OS=Macroscelides proboscideus GN=AQP2 PE=3 SV=1 51 150 1.0E-06
sp|A4L9J0|MIP_RABIT Lens fiber major intrinsic protein OS=Oryctolagus cuniculus GN=MIP PE=2 SV=1 48 320 1.0E-06
sp|O77740|AQP2_TALEU Aquaporin-2 (Fragment) OS=Talpa europaea GN=AQP2 PE=3 SV=1 51 150 1.0E-06
sp|P61838|PIP11_VICFA Aquaporin PIP1.1 OS=Vicia faba GN=PIP1.1 PE=2 SV=1 54 296 1.0E-06
sp|P61837|PIP11_ARATH Aquaporin PIP1-1 OS=Arabidopsis thaliana GN=PIP1-1 PE=1 SV=1 54 296 1.0E-06
sp|O77714|AQP2_DUGDU Aquaporin-2 (Fragment) OS=Dugong dugon GN=AQP2 PE=3 SV=1 51 150 1.0E-06
sp|P79144|AQP2_CANLF Aquaporin-2 (Fragment) OS=Canis lupus familiaris GN=AQP2 PE=3 SV=1 51 150 1.0E-06
sp|P51180|MIP_MOUSE Lens fiber major intrinsic protein OS=Mus musculus GN=Mip PE=1 SV=2 48 320 1.0E-06
sp|Q6J8I9|MIP_SHEEP Lens fiber major intrinsic protein OS=Ovis aries GN=MIP PE=1 SV=1 48 322 2.0E-06
sp|O77697|AQP2_AMBHO Aquaporin-2 (Fragment) OS=Amblysomus hottentotus GN=AQP2 PE=3 SV=1 51 150 2.0E-06
sp|P30301|MIP_HUMAN Lens fiber major intrinsic protein OS=Homo sapiens GN=MIP PE=1 SV=1 48 297 2.0E-06
sp|P09011|MIP_RAT Lens fiber major intrinsic protein (Fragment) OS=Rattus norvegicus GN=Mip PE=1 SV=2 48 320 2.0E-06
sp|P79168|AQP2_ELEMA Aquaporin-2 (Fragment) OS=Elephas maximus GN=AQP2 PE=3 SV=1 51 150 2.0E-06
sp|Q7NNP3|AQPZ_GLOVI Aquaporin Z OS=Gloeobacter violaceus (strain PCC 7421) GN=aqpZ PE=3 SV=1 54 296 3.0E-06
sp|O77722|AQP2_ERIEU Aquaporin-2 (Fragment) OS=Erinaceus europaeus GN=AQP2 PE=3 SV=1 51 150 3.0E-06
sp|P79200|AQP2_ORYAF Aquaporin-2 (Fragment) OS=Orycteropus afer GN=AQP2 PE=3 SV=1 51 150 5.0E-06
sp|P79164|AQP2_DASNO Aquaporin-2 (Fragment) OS=Dasypus novemcinctus GN=AQP2 PE=3 SV=1 51 150 5.0E-06
sp|Q5Z9E2|NIP14_ORYSJ Aquaporin NIP1-4 OS=Oryza sativa subsp. japonica GN=NIP1-4 PE=2 SV=1 15 300 6.0E-06
sp|Q9WTY0|AQP6_RAT Aquaporin-6 OS=Rattus norvegicus GN=Aqp6 PE=1 SV=1 45 336 7.0E-06
sp|Q23808|AQP_CICVR Aquaporin AQPcic OS=Cicadella viridis GN=AQP PE=1 SV=1 54 292 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0015267 channel activity Yes
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0022857 transmembrane transporter activity No
GO:0006810 transport No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0022803 passive transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.45

Transmembrane Domains

Domain # Start End Length
1 57 79 22
2 89 111 22
3 131 153 22
4 192 211 19
5 224 246 22
6 266 288 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8118
MGSPANLDCNESPVSSAPPQHQHQHQQPQPQPPVQMHEPLHHSLLWPRIRAWGRDAFSEFVGTMVLVLFGDGVVA
QVVLSNSTKGDYQSISWGWGIGVMLGVYCAGKSGGHINPAVTLANCVFRGHPWRKLPVYAAAQVLGAMAGAFIVY
GNYKSAIDHYEGGPGIRTVSGPNATAGIFCTYPASFMTRTGMFFSEFIASSILQFVIYALLDTDNLAAGPLLPLC
LLFLIFGIGACFGWETGYAINLARDFGPRLVSYMLGYGSEVWSAGGYYFWIPMVAPFLGTLTGGALYDLFIYTGE
SPINSPWLGLDRIFRPRPSDPEDSRPKSLEQSNSHEASNV
Coding >Ophio5|8118
ATGGGCTCTCCGGCAAATCTCGACTGTAATGAGTCGCCTGTTTCCTCGGCGCCGCCGCAGCATCAGCATCAGCAT
CAGCAGCCGCAGCCGCAGCCACCGGTGCAGATGCATGAGCCGCTGCACCACAGCCTCCTTTGGCCCAGAATCCGA
GCCTGGGGACGAGATGCCTTTTCAGAGTTTGTCGGCACCATGGTGCTCGTCTTGTTCGGGGACGGTGTCGTCGCC
CAGGTGGTGCTTAGCAACAGTACCAAGGGCGACTATCAGAGCATATCCTGGGGCTGGGGCATCGGCGTCATGCTC
GGCGTCTACTGCGCCGGCAAATCGGGAGGCCACATCAACCCAGCCGTGACTCTGGCCAACTGCGTCTTCCGTGGC
CATCCATGGCGAAAGCTGCCCGTCTACGCGGCGGCTCAGGTGCTCGGTGCCATGGCCGGCGCCTTCATCGTCTAC
GGAAACTACAAGTCGGCCATCGACCACTACGAGGGCGGGCCCGGCATCCGGACCGTCAGCGGACCCAACGCCACG
GCCGGAATCTTCTGCACCTATCCGGCTTCCTTCATGACTCGGACAGGCATGTTCTTCTCCGAGTTTATCGCCAGC
TCTATCCTTCAGTTTGTCATCTACGCCCTTCTTGACACCGACAATTTGGCGGCCGGCCCTCTTCTACCGCTCTGC
CTGCTCTTCCTCATCTTTGGCATCGGCGCCTGCTTCGGATGGGAGACGGGCTACGCCATCAACCTGGCTCGTGAC
TTTGGTCCCCGCCTCGTGTCGTATATGCTGGGGTACGGCTCCGAGGTCTGGTCCGCCGGCGGCTACTACTTTTGG
ATACCTATGGTGGCTCCTTTCCTCGGCACGCTGACGGGAGGCGCCCTGTACGACCTCTTCATTTACACGGGAGAG
AGCCCCATCAACTCACCTTGGCTCGGCTTGGACCGCATCTTCCGACCGAGGCCCAGCGACCCGGAAGATTCGCGG
CCCAAGTCGCTCGAGCAGAGCAACTCGCACGAAGCCAGCAACGTG
Transcript >Ophio5|8118
ATGGGCTCTCCGGCAAATCTCGACTGTAATGAGTCGCCTGTTTCCTCGGCGCCGCCGCAGCATCAGCATCAGCAT
CAGCAGCCGCAGCCGCAGCCACCGGTGCAGATGCATGAGCCGCTGCACCACAGCCTCCTTTGGCCCAGAATCCGA
GCCTGGGGACGAGATGCCTTTTCAGAGTTTGTCGGCACCATGGTGCTCGTCTTGTTCGGGGACGGTGTCGTCGCC
CAGGTGGTGCTTAGCAACAGTACCAAGGGCGACTATCAGAGCATATCCTGGGGCTGGGGCATCGGCGTCATGCTC
GGCGTCTACTGCGCCGGCAAATCGGGAGGCCACATCAACCCAGCCGTGACTCTGGCCAACTGCGTCTTCCGTGGC
CATCCATGGCGAAAGCTGCCCGTCTACGCGGCGGCTCAGGTGCTCGGTGCCATGGCCGGCGCCTTCATCGTCTAC
GGAAACTACAAGTCGGCCATCGACCACTACGAGGGCGGGCCCGGCATCCGGACCGTCAGCGGACCCAACGCCACG
GCCGGAATCTTCTGCACCTATCCGGCTTCCTTCATGACTCGGACAGGCATGTTCTTCTCCGAGTTTATCGCCAGC
TCTATCCTTCAGTTTGTCATCTACGCCCTTCTTGACACCGACAATTTGGCGGCCGGCCCTCTTCTACCGCTCTGC
CTGCTCTTCCTCATCTTTGGCATCGGCGCCTGCTTCGGATGGGAGACGGGCTACGCCATCAACCTGGCTCGTGAC
TTTGGTCCCCGCCTCGTGTCGTATATGCTGGGGTACGGCTCCGAGGTCTGGTCCGCCGGCGGCTACTACTTTTGG
ATACCTATGGTGGCTCCTTTCCTCGGCACGCTGACGGGAGGCGCCCTGTACGACCTCTTCATTTACACGGGAGAG
AGCCCCATCAACTCACCTTGGCTCGGCTTGGACCGCATCTTCCGACCGAGGCCCAGCGACCCGGAAGATTCGCGG
CCCAAGTCGCTCGAGCAGAGCAACTCGCACGAAGCCAGCAACGTGTAA
Gene >Ophio5|8118
ATGGGCTCTCCGGCAAATCTCGACTGTAATGAGTCGCCTGTTTCCTCGGCGCCGCCGCAGCATCAGCATCAGCAT
CAGCAGCCGCAGCCGCAGCCACCGGTGCAGATGCATGAGCCGCTGCACCACAGCCTCCTTTGGCCCAGAATCCGA
GCCTGGGGACGAGATGCCTTTTCAGAGTTTGTCGGCACCATGGTGCTCGTCTTGTTCGGGGACGGTGTCGTCGCC
CAGGTGGTGCTTAGCAACAGTACCAAGGGCGACTATCAGAGCATATCCTGGGGCTGGGGGTGAGTTTTTGACTTG
TTTCTTTTTCTTTCGCTTCAATCTTTGCCATGCCTCTTCCCTTGTCCTCTTTCGGGCTCGCACCCTTCCCTGCCA
AGTCTTGTTATACCCGTCCTTTCCTCCGGCTAGTACCAGTACCAGGTTCTAACAGCCCTTTCCAAGCATCGGCGT
CATGCTCGGCGTCTACTGCGCCGGCAAATCGGGAGGCCACATCAACCCAGCCGTGACTCTGGCCAACTGCGTCTT
CCGTGGCCATCCATGGCGAAAGCTGCCCGTCTACGCGGCGGCTCAGGTGCTCGGTGCCATGGCCGGCGCCTTCAT
CGTCTACGGAAACTACAAGTCGGCCATCGACCACTACGAGGGCGGGCCCGGCATCCGGACCGTCAGCGGACCCAA
CGCCACGGCCGGAATCTTCTGCACCTATCCGGCTTCCTTCATGACTCGGACAGGCATGTTCTTCTCCGAGTTTAT
CGCCAGCTCTATCCTTCAGTTTGTCATCTACGCCCTTCTTGACACCGACAATTTGGCGGCCGGCCCTCTTCTACC
GCTCTGCCTGCTCTTCCTCATCTTTGGCATCGGCGCCTGCTTCGGATGGGAGACGGGCTACGCCATCAACCTGGC
TCGTGACTTTGGTCCCCGCCTCGTGTCGTATATGCTGGGGTACGGCTCCGAGGTCTGGTCCGCCGGCGGCTACTA
CTTTTGGGTGAGACTTACCGCTTTTCTCAACACCCCGTCTGTGCGCATCTGACATGTGTGTGCAACGCAGATACC
TATGGTGGCTCCTTTCCTCGGCACGCTGACGGGAGGCGCCCTGTACGACCTCTTCATTTACACGGGAGAGAGCCC
CATCAACTCACCTTGGCTCGGCTTGGACCGCATCTTCCGACCGAGGCCCAGCGACCCGGAAGATTCGCGGCCCAA
GTCGCTCGAGCAGAGCAACTCGCACGAAGCCAGCAACGTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail