Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8112
Gene name
Locationscaffold_860:1716..3373
Strand+
Gene length (bp)1657
Transcript length (bp)1584
Coding sequence length (bp)1581
Protein length (aa) 527

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01757 Acyl_transf_3 Acyltransferase family 1.5E-42 104 506

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups Yes
GO:0016746 acyltransferase activity No
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 112 134 22
2 149 171 22
3 198 220 22
4 278 300 22
5 479 501 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8112
MTAPADPRSPPFFDDKMGLVASSDTDSDADVELDAAAPFLSKASSLNQPSRRQGLFPLASVAAFLASTPWRLLIL
RLLNFLTPSFLQRHHAREQTCPPRLSPTAYLDGMRGLAALFVYFCHYTYQSFFIARSWGYADGNYQILKLPFLRL
WYQGPQAVCVFFVISGYALSYRPLKLMRSRAMADFSTTMSSLTFRRGLRLYLPTAISTLMIICLLRLGAYGWTRE
FAHDRTYMRNVVEPHPARMDSAYDQFRDWAVQMYRFLHVFSWDMDGGRIPYDVHLWTIPVEFRCSLFLFLVIIGT
ARLRTRFRLLIVAALLWFTYRHSRWELVLFLCGMLLAEWDLIRAAHVSPPALPQDEKAATATARPLWNRMFWTLI
SIIGLYLLCQPDEGGSETPGWRLLTSMIPSWWGAEQYRFWQSAGAVVFVAAVGHSSGWQKFFNLPAIQYLGKISY
ALYLMHGPAMHTVGYHFEKWAYSLTGVDGYWYNAGFVLGACFCVPTVIWWADVFWRAVDVPTVRFAKWVEGKCIV
KA
Coding >Ophio5|8112
ATGACCGCCCCCGCCGACCCCAGGTCTCCTCCCTTCTTCGACGACAAAATGGGCCTCGTCGCCTCTTCGGACACG
GACAGCGACGCCGATGTCGAGCTCGACGCCGCCGCTCCCTTCCTCAGCAAGGCTTCCTCTCTCAACCAACCCTCA
CGTCGCCAAGGCCTCTTCCCCTTGGCTTCTGTCGCCGCCTTCCTCGCCTCGACGCCCTGGCGCCTCTTGATACTA
CGCCTCCTCAACTTCCTGACGCCGAGCTTCCTACAGCGCCATCACGCCCGCGAGCAGACATGCCCCCCCCGCCTG
TCCCCGACGGCCTACCTCGACGGCATGCGCGGCTTGGCCGCCCTCTTCGTCTACTTCTGCCACTACACCTACCAG
TCCTTCTTCATTGCCAGGAGCTGGGGTTACGCCGACGGCAACTACCAGATTCTCAAGCTCCCTTTCCTTCGCCTG
TGGTATCAGGGTCCCCAGGCCGTATGCGTCTTCTTCGTCATCTCCGGCTACGCCCTGTCCTATCGTCCCCTCAAG
CTGATGCGCAGCCGCGCCATGGCCGACTTCTCCACCACCATGAGCTCCCTGACCTTTCGGCGTGGCCTGCGCCTG
TACCTGCCTACGGCCATCTCCACCTTGATGATAATCTGTCTGCTCCGCCTGGGTGCCTACGGATGGACCCGCGAG
TTTGCCCACGACAGGACCTATATGCGCAACGTCGTCGAGCCCCATCCCGCACGCATGGACAGCGCCTACGACCAG
TTTCGAGACTGGGCCGTGCAAATGTATCGATTCCTTCACGTCTTTAGTTGGGACATGGATGGCGGGAGAATCCCG
TACGACGTGCATTTGTGGACCATTCCCGTCGAGTTCCGCTGCTCGCTTTTCCTCTTCCTCGTCATCATCGGCACT
GCCCGGCTGCGGACTAGGTTTCGGCTGCTGATCGTCGCCGCCCTCCTGTGGTTCACCTACCGCCACTCCAGGTGG
GAGCTCGTTCTCTTCCTCTGCGGCATGCTCCTTGCCGAGTGGGATCTCATCCGCGCCGCGCACGTCAGTCCACCC
GCCCTGCCTCAGGATGAAAAGGCGGCGACAGCAACTGCGCGGCCCTTGTGGAATAGGATGTTCTGGACCTTGATC
AGCATAATTGGCCTCTACCTACTGTGCCAGCCCGACGAAGGTGGAAGCGAGACACCCGGCTGGCGTCTGCTCACG
TCCATGATTCCGTCGTGGTGGGGGGCCGAGCAGTACCGCTTCTGGCAGTCGGCCGGTGCCGTTGTCTTCGTCGCC
GCCGTCGGCCACTCGAGCGGCTGGCAGAAATTCTTCAACCTGCCGGCCATTCAGTACCTTGGAAAGATCTCATAC
GCCCTCTACCTGATGCACGGGCCGGCCATGCACACGGTCGGCTACCACTTCGAGAAGTGGGCGTACAGCCTGACC
GGGGTGGACGGTTACTGGTACAACGCAGGCTTCGTCCTGGGCGCTTGCTTCTGTGTGCCGACGGTCATCTGGTGG
GCTGACGTGTTCTGGAGAGCCGTCGACGTGCCGACGGTGCGGTTTGCCAAGTGGGTCGAGGGGAAGTGCATCGTT
AAGGCC
Transcript >Ophio5|8112
ATGACCGCCCCCGCCGACCCCAGGTCTCCTCCCTTCTTCGACGACAAAATGGGCCTCGTCGCCTCTTCGGACACG
GACAGCGACGCCGATGTCGAGCTCGACGCCGCCGCTCCCTTCCTCAGCAAGGCTTCCTCTCTCAACCAACCCTCA
CGTCGCCAAGGCCTCTTCCCCTTGGCTTCTGTCGCCGCCTTCCTCGCCTCGACGCCCTGGCGCCTCTTGATACTA
CGCCTCCTCAACTTCCTGACGCCGAGCTTCCTACAGCGCCATCACGCCCGCGAGCAGACATGCCCCCCCCGCCTG
TCCCCGACGGCCTACCTCGACGGCATGCGCGGCTTGGCCGCCCTCTTCGTCTACTTCTGCCACTACACCTACCAG
TCCTTCTTCATTGCCAGGAGCTGGGGTTACGCCGACGGCAACTACCAGATTCTCAAGCTCCCTTTCCTTCGCCTG
TGGTATCAGGGTCCCCAGGCCGTATGCGTCTTCTTCGTCATCTCCGGCTACGCCCTGTCCTATCGTCCCCTCAAG
CTGATGCGCAGCCGCGCCATGGCCGACTTCTCCACCACCATGAGCTCCCTGACCTTTCGGCGTGGCCTGCGCCTG
TACCTGCCTACGGCCATCTCCACCTTGATGATAATCTGTCTGCTCCGCCTGGGTGCCTACGGATGGACCCGCGAG
TTTGCCCACGACAGGACCTATATGCGCAACGTCGTCGAGCCCCATCCCGCACGCATGGACAGCGCCTACGACCAG
TTTCGAGACTGGGCCGTGCAAATGTATCGATTCCTTCACGTCTTTAGTTGGGACATGGATGGCGGGAGAATCCCG
TACGACGTGCATTTGTGGACCATTCCCGTCGAGTTCCGCTGCTCGCTTTTCCTCTTCCTCGTCATCATCGGCACT
GCCCGGCTGCGGACTAGGTTTCGGCTGCTGATCGTCGCCGCCCTCCTGTGGTTCACCTACCGCCACTCCAGGTGG
GAGCTCGTTCTCTTCCTCTGCGGCATGCTCCTTGCCGAGTGGGATCTCATCCGCGCCGCGCACGTCAGTCCACCC
GCCCTGCCTCAGGATGAAAAGGCGGCGACAGCAACTGCGCGGCCCTTGTGGAATAGGATGTTCTGGACCTTGATC
AGCATAATTGGCCTCTACCTACTGTGCCAGCCCGACGAAGGTGGAAGCGAGACACCCGGCTGGCGTCTGCTCACG
TCCATGATTCCGTCGTGGTGGGGGGCCGAGCAGTACCGCTTCTGGCAGTCGGCCGGTGCCGTTGTCTTCGTCGCC
GCCGTCGGCCACTCGAGCGGCTGGCAGAAATTCTTCAACCTGCCGGCCATTCAGTACCTTGGAAAGATCTCATAC
GCCCTCTACCTGATGCACGGGCCGGCCATGCACACGGTCGGCTACCACTTCGAGAAGTGGGCGTACAGCCTGACC
GGGGTGGACGGTTACTGGTACAACGCAGGCTTCGTCCTGGGCGCTTGCTTCTGTGTGCCGACGGTCATCTGGTGG
GCTGACGTGTTCTGGAGAGCCGTCGACGTGCCGACGGTGCGGTTTGCCAAGTGGGTCGAGGGGAAGTGCATCGTT
AAGGCCTAA
Gene >Ophio5|8112
ATGACCGCCCCCGCCGACCCCAGGTCTCCTCCCTTCTTCGACGACAAAATGGGCCTCGTCGCCTCTTCGGACACG
GACAGCGACGCCGATGTCGAGCTCGACGCCGCCGCTCCCTTCCTCAGCAAGGCTTCCTCTCTCAACCAACCCTCA
CGTCGCCAAGGCCTCTTCCCCTTGGCTTCTGTCGCCGCCTTCCTCGCCTCGACGCCCTGGCGCCTCTTGATACTA
CGCCTCCTCAACTTCCTGACGCCGAGCTTCCTACAGCGCCATCACGCCCGCGAGCAGACATGCCCCCCCCGCCTG
TCCCCGACGGCCTACCTCGACGGCATGCGCGGCTTGGCCGCCCTCTTCGTCTACTTCTGCCACTACACCTACCAG
TCCTTCTTCATTGCCAGGAGCTGGGGTTACGCCGACGGCAACTACCAGATTCTCAAGCTCCCTTTCCTTCGCCTG
TGGTATCAGGGTCCCCAGGCCGTATGCGTCTTCTTCGTCATCTCCGGCTACGCCCTGTCCTATCGTCCCCTCAAG
CTGATGCGCAGCCGCGCCATGGCCGACTTCTCCACCACCATGAGCTCCCTGACCTTTCGGCGTGGCCTGCGCCTG
TACCTGCCTACGGCCATCTCCACCTTGATGATAATCTGTCTGCTCCGCCTGGGTGCCTACGGATGGACCCGCGAG
TTTGCCCACGACAGGACCTATATGCGCAACGTCGTCGAGCCCCATCCCGCACGCATGGACAGCGCCTACGACCAG
TTTCGAGACTGGGCCGTGCAAATGTATCGATTCCTTCACGTCTTTAGTTGGGACATGGATGGCGGGAGAATCCGT
GAGATCCCCCGGTCCATTTTTTTCCTTTTTCTCTCTCATCTCCCCCCGAAAGCTGACCCTGTCTCGAACAGCGTA
CGACGTGCATTTGTGGACCATTCCCGTCGAGTTCCGCTGCTCGCTTTTCCTCTTCCTCGTCATCATCGGCACTGC
CCGGCTGCGGACTAGGTTTCGGCTGCTGATCGTCGCCGCCCTCCTGTGGTTCACCTACCGCCACTCCAGGTGGGA
GCTCGTTCTCTTCCTCTGCGGCATGCTCCTTGCCGAGTGGGATCTCATCCGCGCCGCGCACGTCAGTCCACCCGC
CCTGCCTCAGGATGAAAAGGCGGCGACAGCAACTGCGCGGCCCTTGTGGAATAGGATGTTCTGGACCTTGATCAG
CATAATTGGCCTCTACCTACTGTGCCAGCCCGACGAAGGTGGAAGCGAGACACCCGGCTGGCGTCTGCTCACGTC
CATGATTCCGTCGTGGTGGGGGGCCGAGCAGTACCGCTTCTGGCAGTCGGCCGGTGCCGTTGTCTTCGTCGCCGC
CGTCGGCCACTCGAGCGGCTGGCAGAAATTCTTCAACCTGCCGGCCATTCAGTACCTTGGAAAGATCTCATACGC
CCTCTACCTGATGCACGGGCCGGCCATGCACACGGTCGGCTACCACTTCGAGAAGTGGGCGTACAGCCTGACCGG
GGTGGACGGTTACTGGTACAACGCAGGCTTCGTCCTGGGCGCTTGCTTCTGTGTGCCGACGGTCATCTGGTGGGC
TGACGTGTTCTGGAGAGCCGTCGACGTGCCGACGGTGCGGTTTGCCAAGTGGGTCGAGGGGAAGTGCATCGTTAA
GGCCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail