Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8111
Gene name
Locationscaffold_86:46999..48595
Strand+
Gene length (bp)1596
Transcript length (bp)1452
Coding sequence length (bp)1449
Protein length (aa) 483

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02096 60KD_IMP 60Kd inner membrane protein 4.0E-12 190 384

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P39952|OXA1_YEAST Mitochondrial inner membrane protein OXA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OXA1 PE=1 SV=1 86 472 4.0E-24
sp|O13375|OXA1_KAZSE Mitochondrial inner membrane protein OXA1 OS=Kazachstania servazzii GN=OXA1 PE=3 SV=1 158 463 1.0E-17
sp|Q15070|OXA1L_HUMAN Mitochondrial inner membrane protein OXA1L OS=Homo sapiens GN=OXA1L PE=1 SV=3 120 395 1.0E-12
sp|Q8BGA9|OXA1L_MOUSE Mitochondrial inner membrane protein OXA1L OS=Mus musculus GN=Oxa1l PE=1 SV=1 120 395 1.0E-12
sp|O14300|OXA11_SCHPO Mitochondrial inner membrane protein oxa1-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=oxa101 PE=2 SV=1 164 483 6.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P39952|OXA1_YEAST Mitochondrial inner membrane protein OXA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OXA1 PE=1 SV=1 86 472 4.0E-24
sp|O13375|OXA1_KAZSE Mitochondrial inner membrane protein OXA1 OS=Kazachstania servazzii GN=OXA1 PE=3 SV=1 158 463 1.0E-17
sp|Q15070|OXA1L_HUMAN Mitochondrial inner membrane protein OXA1L OS=Homo sapiens GN=OXA1L PE=1 SV=3 120 395 1.0E-12
sp|Q8BGA9|OXA1L_MOUSE Mitochondrial inner membrane protein OXA1L OS=Mus musculus GN=Oxa1l PE=1 SV=1 120 395 1.0E-12
sp|O14300|OXA11_SCHPO Mitochondrial inner membrane protein oxa1-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=oxa101 PE=2 SV=1 164 483 6.0E-12
sp|Q42191|OXA1_ARATH Mitochondrial inner membrane protein OXA1 OS=Arabidopsis thaliana GN=OXA1 PE=2 SV=2 130 397 9.0E-12
sp|O43092|OXA12_SCHPO Mitochondrial inner membrane protein oxa1-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=oxa102 PE=2 SV=2 167 342 1.0E-09
sp|Q3SYV3|OXA1L_BOVIN Mitochondrial inner membrane protein OXA1L OS=Bos taurus GN=OXA1L PE=2 SV=1 141 395 3.0E-09
sp|Q9SKD3|OXA1L_ARATH Mitochondrial inner membrane protein OXA1-like OS=Arabidopsis thaliana GN=OXA1L PE=2 SV=1 171 395 8.0E-09
sp|Q13SH4|YIDC_BURXL Membrane protein insertase YidC OS=Burkholderia xenovorans (strain LB400) GN=yidC PE=3 SV=1 119 336 3.0E-08
sp|B2T7U1|YIDC_BURPP Membrane protein insertase YidC OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=yidC PE=3 SV=1 119 336 3.0E-08
sp|A4VS82|YIDC_PSEU5 Membrane protein insertase YidC OS=Pseudomonas stutzeri (strain A1501) GN=yidC PE=3 SV=1 126 353 3.0E-08
sp|Q3JXI3|YIDC_BURP1 Membrane protein insertase YidC OS=Burkholderia pseudomallei (strain 1710b) GN=yidC PE=3 SV=1 114 336 8.0E-08
sp|A3NPX1|YIDC_BURP0 Membrane protein insertase YidC OS=Burkholderia pseudomallei (strain 1106a) GN=yidC PE=3 SV=1 114 336 8.0E-08
sp|A3N477|YIDC_BURP6 Membrane protein insertase YidC OS=Burkholderia pseudomallei (strain 668) GN=yidC PE=3 SV=1 114 336 8.0E-08
sp|Q63YW1|YIDC_BURPS Membrane protein insertase YidC OS=Burkholderia pseudomallei (strain K96243) GN=yidC PE=3 SV=1 114 336 8.0E-08
sp|Q2STM0|YIDC_BURTA Membrane protein insertase YidC OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=yidC PE=3 SV=1 114 336 8.0E-08
sp|Q9HT06|YIDC_PSEAE Membrane protein insertase YidC OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=yidC PE=3 SV=1 163 356 2.0E-07
sp|Q02DE0|YIDC_PSEAB Membrane protein insertase YidC OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=yidC PE=3 SV=1 163 356 2.0E-07
sp|B7V7A5|YIDC_PSEA8 Membrane protein insertase YidC OS=Pseudomonas aeruginosa (strain LESB58) GN=yidC PE=3 SV=1 163 356 2.0E-07
sp|A6VF45|YIDC_PSEA7 Membrane protein insertase YidC OS=Pseudomonas aeruginosa (strain PA7) GN=yidC PE=3 SV=1 163 356 2.0E-07
sp|A1V7D5|YIDC_BURMS Membrane protein insertase YidC OS=Burkholderia mallei (strain SAVP1) GN=yidC PE=3 SV=1 114 336 2.0E-07
sp|Q62EM4|YIDC_BURMA Membrane protein insertase YidC OS=Burkholderia mallei (strain ATCC 23344) GN=yidC PE=3 SV=1 114 336 2.0E-07
sp|A2S8D6|YIDC_BURM9 Membrane protein insertase YidC OS=Burkholderia mallei (strain NCTC 10229) GN=yidC PE=3 SV=1 114 336 2.0E-07
sp|A3MS20|YIDC_BURM7 Membrane protein insertase YidC OS=Burkholderia mallei (strain NCTC 10247) GN=yidC PE=3 SV=1 114 336 2.0E-07
sp|A9ACA0|YIDC_BURM1 Membrane protein insertase YidC OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=yidC PE=3 SV=1 114 336 3.0E-07
sp|Q39BQ2|YIDC_BURL3 Membrane protein insertase YidC OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=yidC PE=3 SV=1 114 336 3.0E-07
sp|B2JJR8|YIDC_BURP8 Membrane protein insertase YidC OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=yidC PE=3 SV=1 166 336 4.0E-07
sp|Q1BSF7|YIDC_BURCA Membrane protein insertase YidC OS=Burkholderia cenocepacia (strain AU 1054) GN=yidC PE=3 SV=1 114 336 5.0E-07
sp|A0KBN3|YIDC_BURCH Membrane protein insertase YidC OS=Burkholderia cenocepacia (strain HI2424) GN=yidC PE=3 SV=1 114 336 5.0E-07
sp|Q7NPT8|YIDC_CHRVO Membrane protein insertase YidC OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=yidC PE=3 SV=1 122 331 6.0E-07
sp|Q5P4P4|YIDC_AROAE Membrane protein insertase YidC OS=Aromatoleum aromaticum (strain EbN1) GN=yidC PE=3 SV=1 163 336 7.0E-07
sp|A4Y1A0|YIDC_PSEMY Membrane protein insertase YidC OS=Pseudomonas mendocina (strain ymp) GN=yidC PE=3 SV=1 163 353 9.0E-07
sp|Q87TS1|YIDC_PSESM Membrane protein insertase YidC OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=yidC PE=3 SV=1 163 356 9.0E-07
sp|Q477Q4|YIDC_DECAR Membrane protein insertase YidC OS=Dechloromonas aromatica (strain RCB) GN=yidC PE=3 SV=1 163 336 1.0E-06
sp|Q1I2H4|YIDC_PSEE4 Membrane protein insertase YidC OS=Pseudomonas entomophila (strain L48) GN=yidC PE=3 SV=1 163 356 1.0E-06
sp|B1K0Y4|YIDC_BURCC Membrane protein insertase YidC OS=Burkholderia cenocepacia (strain MC0-3) GN=yidC PE=3 SV=1 106 336 1.0E-06
sp|B4E7D5|YIDC_BURCJ Membrane protein insertase YidC OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=yidC PE=3 SV=1 106 336 1.0E-06
sp|Q7VJY0|YIDC_HELHP Membrane protein insertase YidC OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=yidC PE=3 SV=1 179 338 1.0E-06
sp|Q48BF2|YIDC_PSE14 Membrane protein insertase YidC OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=yidC PE=3 SV=1 163 356 1.0E-06
sp|Q4ZL11|YIDC_PSEU2 Membrane protein insertase YidC OS=Pseudomonas syringae pv. syringae (strain B728a) GN=yidC PE=3 SV=1 163 356 1.0E-06
sp|A5WBB7|YIDC_PSEP1 Membrane protein insertase YidC OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=yidC PE=3 SV=1 163 356 2.0E-06
sp|Q21DG0|YIDC_SACD2 Membrane protein insertase YidC OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=yidC PE=3 SV=1 123 336 2.0E-06
sp|C1DNF7|YIDC_AZOVD Membrane protein insertase YidC OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=yidC PE=3 SV=1 163 356 2.0E-06
sp|B1JFV4|YIDC_PSEPW Membrane protein insertase YidC OS=Pseudomonas putida (strain W619) GN=yidC PE=3 SV=1 163 356 2.0E-06
sp|B0KRC1|YIDC_PSEPG Membrane protein insertase YidC OS=Pseudomonas putida (strain GB-1) GN=yidC PE=3 SV=1 163 356 2.0E-06
sp|P0A140|YIDC_PSEPK Membrane protein insertase YidC OS=Pseudomonas putida (strain KT2440) GN=yidC PE=3 SV=1 163 356 2.0E-06
sp|P0A141|YIDC_PSEPU Membrane protein insertase YidC OS=Pseudomonas putida GN=yidC PE=3 SV=1 163 356 2.0E-06
sp|Q8Y3H6|YIDC_RALSO Membrane protein insertase YidC OS=Ralstonia solanacearum (strain GMI1000) GN=yidC PE=3 SV=1 166 336 3.0E-06
sp|B1YQJ7|YIDC_BURA4 Membrane protein insertase YidC OS=Burkholderia ambifaria (strain MC40-6) GN=yidC PE=3 SV=1 119 336 3.0E-06
sp|C6DYS1|YIDC_GEOSM Membrane protein insertase YidC OS=Geobacter sp. (strain M21) GN=yidC PE=3 SV=1 165 355 4.0E-06
sp|Q5F4W6|YIDC_NEIG1 Membrane protein insertase YidC OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=yidC PE=3 SV=1 163 352 6.0E-06
sp|B4RJJ2|YIDC_NEIG2 Membrane protein insertase YidC OS=Neisseria gonorrhoeae (strain NCCP11945) GN=yidC PE=3 SV=1 163 352 7.0E-06
sp|Q0BAQ2|YIDC_BURCM Membrane protein insertase YidC OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=yidC PE=3 SV=1 119 336 8.0E-06
sp|B2U820|YIDC_RALPJ Membrane protein insertase YidC OS=Ralstonia pickettii (strain 12J) GN=yidC PE=3 SV=1 154 336 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0032977 membrane insertase activity Yes
GO:0140597 protein carrier chaperone No
GO:0140104 molecular carrier activity No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0005575 cellular_component No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 184 206 22
2 261 283 22
3 313 332 19
4 345 367 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8111
MLPNRGVVRVFSSVGPSRLVPGRHTSAATSSPGRYFGTLRQSGLSSSPYRPRRLVIASFSPVPSSARALSIWGWS
PSLPGWPSSVPGWSWVSGSNKGESPAPEAAPTSTAQPVVEPTVVEPAVVEPAVVAPASGTSDAPLLADALTADDI
LRIPEQSGYLRALGLDYGWGPTSVMQWSLESVHVYTGLGWAASIVATALLLRVILLYPQYRAMHFSAAFQRMRGD
PRAVKAINLGKTAARDKDLGMQWESRALYKMLKKEYGVSSLGFLWSFMQIPFSYGMFRLINGMASIPVPSMESAG
WLWFTDLAHRDPYFILPTTATTLMITSVLINSRNNPAGTNKLLKPLVYIIAFVGLFVTSFLSSAVNLMATTFGAA
TLATTYLFNNAAVRRNLGLPALGPKPLRPIPKLVYEAPRSPSTTLRGRIADGIGDMKKNFREQLTSFGGSEPEDK
AASQRRQMLRRAEEARRQSRSNEFERKYKGVGR
Coding >Ophio5|8111
ATGCTTCCCAACCGGGGAGTCGTCCGTGTATTTTCCTCCGTCGGGCCTTCGAGGCTGGTTCCGGGCCGTCATACG
AGCGCGGCCACTTCTTCCCCGGGCCGTTACTTCGGAACTCTGCGACAGAGTGGCCTTTCATCTTCGCCCTATCGC
CCACGCCGTCTCGTCATCGCCTCGTTCAGCCCTGTTCCGTCTTCTGCCCGGGCCTTGTCGATATGGGGATGGTCG
CCTTCTCTCCCCGGCTGGCCGTCTTCTGTCCCGGGATGGTCATGGGTGTCCGGCAGTAACAAGGGCGAGTCGCCC
GCTCCGGAAGCTGCGCCTACATCGACGGCTCAACCAGTCGTTGAGCCCACTGTCGTTGAGCCCGCTGTTGTCGAG
CCCGCTGTCGTCGCGCCCGCGTCCGGTACAAGTGACGCCCCGCTCCTCGCCGATGCCCTCACTGCCGACGATATC
CTCCGCATACCTGAACAGTCGGGTTACCTGCGCGCCCTCGGCCTCGACTACGGCTGGGGTCCGACGTCGGTGATG
CAATGGTCGTTGGAAAGTGTCCACGTCTATACGGGCCTCGGCTGGGCCGCCTCCATCGTGGCGACGGCCCTCCTC
CTCCGCGTCATCCTGCTCTACCCGCAGTATCGTGCTATGCATTTCTCCGCCGCCTTCCAGCGCATGAGGGGGGAT
CCTCGGGCGGTCAAAGCCATCAACTTGGGCAAGACGGCAGCGCGCGACAAGGACCTCGGTATGCAGTGGGAAAGC
CGCGCGCTGTACAAGATGCTGAAGAAGGAGTACGGCGTCAGCAGCCTGGGTTTCCTTTGGTCCTTTATGCAGATT
CCATTCAGCTACGGCATGTTTCGTCTCATAAACGGCATGGCGAGCATCCCTGTGCCGTCCATGGAATCGGCAGGC
TGGCTTTGGTTCACGGATCTTGCCCACAGGGATCCTTACTTTATCCTGCCCACTACCGCCACCACCCTCATGATC
ACCTCCGTTTTAATCAACTCCCGAAACAACCCTGCCGGTACAAACAAGCTATTAAAGCCTTTGGTCTACATCATC
GCCTTCGTAGGCCTCTTCGTCACCTCCTTCCTCTCCAGCGCCGTCAACCTTATGGCCACAACCTTCGGCGCCGCA
ACGCTAGCCACGACTTACCTTTTCAACAACGCCGCCGTCCGTCGCAACTTGGGCCTGCCAGCTCTCGGCCCCAAG
CCCCTCCGCCCCATCCCGAAGCTCGTTTACGAGGCTCCGAGGTCTCCATCCACCACTCTCCGTGGACGAATCGCC
GACGGCATCGGCGACATGAAAAAGAACTTTAGAGAACAGCTGACCAGCTTCGGTGGCTCCGAACCTGAAGACAAG
GCCGCTAGTCAGCGTCGCCAGATGCTGCGGAGGGCTGAAGAGGCCCGCAGACAGAGCCGCAGTAACGAATTCGAA
AGGAAATACAAGGGCGTCGGTAGG
Transcript >Ophio5|8111
ATGCTTCCCAACCGGGGAGTCGTCCGTGTATTTTCCTCCGTCGGGCCTTCGAGGCTGGTTCCGGGCCGTCATACG
AGCGCGGCCACTTCTTCCCCGGGCCGTTACTTCGGAACTCTGCGACAGAGTGGCCTTTCATCTTCGCCCTATCGC
CCACGCCGTCTCGTCATCGCCTCGTTCAGCCCTGTTCCGTCTTCTGCCCGGGCCTTGTCGATATGGGGATGGTCG
CCTTCTCTCCCCGGCTGGCCGTCTTCTGTCCCGGGATGGTCATGGGTGTCCGGCAGTAACAAGGGCGAGTCGCCC
GCTCCGGAAGCTGCGCCTACATCGACGGCTCAACCAGTCGTTGAGCCCACTGTCGTTGAGCCCGCTGTTGTCGAG
CCCGCTGTCGTCGCGCCCGCGTCCGGTACAAGTGACGCCCCGCTCCTCGCCGATGCCCTCACTGCCGACGATATC
CTCCGCATACCTGAACAGTCGGGTTACCTGCGCGCCCTCGGCCTCGACTACGGCTGGGGTCCGACGTCGGTGATG
CAATGGTCGTTGGAAAGTGTCCACGTCTATACGGGCCTCGGCTGGGCCGCCTCCATCGTGGCGACGGCCCTCCTC
CTCCGCGTCATCCTGCTCTACCCGCAGTATCGTGCTATGCATTTCTCCGCCGCCTTCCAGCGCATGAGGGGGGAT
CCTCGGGCGGTCAAAGCCATCAACTTGGGCAAGACGGCAGCGCGCGACAAGGACCTCGGTATGCAGTGGGAAAGC
CGCGCGCTGTACAAGATGCTGAAGAAGGAGTACGGCGTCAGCAGCCTGGGTTTCCTTTGGTCCTTTATGCAGATT
CCATTCAGCTACGGCATGTTTCGTCTCATAAACGGCATGGCGAGCATCCCTGTGCCGTCCATGGAATCGGCAGGC
TGGCTTTGGTTCACGGATCTTGCCCACAGGGATCCTTACTTTATCCTGCCCACTACCGCCACCACCCTCATGATC
ACCTCCGTTTTAATCAACTCCCGAAACAACCCTGCCGGTACAAACAAGCTATTAAAGCCTTTGGTCTACATCATC
GCCTTCGTAGGCCTCTTCGTCACCTCCTTCCTCTCCAGCGCCGTCAACCTTATGGCCACAACCTTCGGCGCCGCA
ACGCTAGCCACGACTTACCTTTTCAACAACGCCGCCGTCCGTCGCAACTTGGGCCTGCCAGCTCTCGGCCCCAAG
CCCCTCCGCCCCATCCCGAAGCTCGTTTACGAGGCTCCGAGGTCTCCATCCACCACTCTCCGTGGACGAATCGCC
GACGGCATCGGCGACATGAAAAAGAACTTTAGAGAACAGCTGACCAGCTTCGGTGGCTCCGAACCTGAAGACAAG
GCCGCTAGTCAGCGTCGCCAGATGCTGCGGAGGGCTGAAGAGGCCCGCAGACAGAGCCGCAGTAACGAATTCGAA
AGGAAATACAAGGGCGTCGGTAGGTAG
Gene >Ophio5|8111
ATGCTTCCCAACCGGGGAGTCGTCCGTGTATTTTCCTCCGTCGGGCCTTCGAGGCTGGTTCCGGGCCGTCATACG
GTGCGCTTCTTCTCCCCTTCGGCCTTACCTAGGTAACCCAACGGGACTTGGACTTAGAGGATAGAAACCTCAGAG
CGCGGCCACTTCTTCCCCGGGCCGTTACTTCGGAACTCTGCGACAGAGTGGCCTTTCATCTTCGCCCTATCGCCC
ACGCCGTCTCGTCATCGCCTCGTTCAGCCCTGTTCCGTCTTCTGCCCGGGCCTTGTCGATATGGGGATGGTCGCC
TTCTCTCCCCGGCTGGCCGTCTTCTGTCCCGGGATGGTCATGGGTGTCCGGCAGTAACAAGGGCGAGTCGCCCGC
TCCGGAAGCTGCGCCTACATCGACGGCTCAACCAGTCGTTGAGCCCACTGTCGTTGAGCCCGCTGTTGTCGAGCC
CGCTGTCGTCGCGCCCGCGTCCGGTACAAGTGACGCCCCGCTCCTCGCCGATGCCCTCACTGCCGACGATATCCT
CCGCATACCTGAACAGTCGGGTTACCTGCGCGCCCTCGGCCTCGACTACGGCTGGGGTCCGACGTCGGTGATGCA
ATGGTCGTTGGAAAGTGTCCACGTCTATACGGGCCTCGGCTGGGCCGCCTCCATCGTGGCGACGGCCCTCCTCCT
CCGCGTCATCCTGCTCTACCCGCAGTATCGTGCTATGCATTTCTCCGCCGCCTTCCAGCGCATGAGGGGGGATCC
TCGGGCGGTCAAAGCCATCAACTTGGGCAAGACGGCAGCGCGCGACAAGGACCTCGGTATGCAGTGGGAAAGCCG
CGCGCTGTACAAGATGCTGAAGAAGGAGTACGGCGTCAGCAGCCTGGGTTTCCTTTGGTCCTTTATGCAGATTCC
ATTCAGCTACGGCATGTTTCGTCTCATAAACGGCATGGCGAGCATCCCTGTGCCGTCCATGGAATCGGCAGGCTG
GCTTTGGTTCACGGATCTTGCCCACAGGGATCCTTACTTTATCCTGCCCACTACCGCCACCACCCTCATGATCAC
CTCCGTTTTAGTACGACATTGAACCCCTTCCGTGTCGAAGTCGTCGTGCTCGTCCCAGCTACTGACTGCTCTCGT
CTACAGATCAACTCCCGAAACAACCCTGCCGGTACAAACAAGCTATTAAAGCCTTTGGTCTACATCATCGCCTTC
GTAGGCCTCTTCGTCACCTCCTTCCTCTCCAGCGCCGTCAACCTTATGGCCACAACCTTCGGCGCCGCAACGCTA
GCCACGACTTACCTTTTCAACAACGCCGCCGTCCGTCGCAACTTGGGCCTGCCAGCTCTCGGCCCCAAGCCCCTC
CGCCCCATCCCGAAGCTCGTTTACGAGGCTCCGAGGTCTCCATCCACCACTCTCCGTGGACGAATCGCCGACGGC
ATCGGCGACATGAAAAAGAACTTTAGAGAACAGCTGACCAGCTTCGGTGGCTCCGAACCTGAAGACAAGGCCGCT
AGTCAGCGTCGCCAGATGCTGCGGAGGGCTGAAGAGGCCCGCAGACAGAGCCGCAGTAACGAATTCGAAAGGAAA
TACAAGGGCGTCGGTAGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail