Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8107
Gene name
Locationscaffold_86:38598..40083
Strand-
Gene length (bp)1485
Transcript length (bp)1485
Coding sequence length (bp)1482
Protein length (aa) 494

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04120 Iron_permease Low affinity iron permease 3.2E-11 171 251
PF04120 Iron_permease Low affinity iron permease 5.8E-19 387 462

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9HFE1|FET4_SCHPO Low-affinity iron/zinc ion transport protein fet4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fet4 PE=2 SV=1 27 485 8.0E-86
sp|P40988|FET4_YEAST Low-affinity Fe(2+) transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FET4 PE=1 SV=2 1 475 5.0E-72

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0051179 localization No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

Domain # Start End Length
1 61 80 19
2 85 104 19
3 178 200 22
4 210 232 22
5 284 306 22
6 321 340 19
7 402 424 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8107
MKRLMALLASYGAKGPIEHTAPTQHVKDEETNVTGYADKAKERALDRWLDRVVQASGSEPVFLFIVTGLVVWAFL
GIPYGHTADWAVLISDVQAIVSYVFDSLLMRQQLNDYEKMVRVSASLRSRAISNKRMLREIVNHAPRRQQQPSVA
LEQLQRPPSSCETLPRETVVDRLSTAAARVVGHLAAICLYWACIAVWLGFGPFCDWSNGWQLAINSATSALMVFI
FAFLANVQERHAVHVQRCLQAIFEHDSAVERALRAMTGDDVANETVVVLAPRMSRIQRVILYYADLVGTLTGIAI
LTAVMVVWLAIGPVMGFSSNWWLLIGTYAGLVGLNDSFVLRNVQMLFNGYAQEALDQVDLDDQSIFDQLRLSDPA
KAPVQAESLSYRISAWMGIVCAHEATVIVGFIFILGLLAGATAMGWSTAGQLLCNIPPSIIETFFMMILITGHNQ
AETKRHERLENFFLRRSVLLSYVQRLEAGHYTMRSVQDSLDHVA
Coding >Ophio5|8107
ATGAAGCGCCTCATGGCATTGCTCGCGTCTTACGGAGCAAAGGGCCCCATCGAGCACACGGCTCCGACGCAACAT
GTCAAGGACGAGGAGACCAACGTCACGGGCTACGCCGACAAGGCCAAAGAGCGGGCACTAGACCGCTGGCTTGAC
CGTGTCGTCCAGGCATCCGGCTCGGAGCCCGTCTTCCTATTCATCGTTACCGGACTCGTCGTCTGGGCCTTTCTC
GGCATCCCGTACGGGCACACCGCTGACTGGGCCGTCCTGATATCCGATGTCCAGGCCATCGTCAGCTACGTCTTC
GACTCGCTGCTCATGCGTCAGCAGCTCAACGATTACGAGAAGATGGTGCGCGTCTCGGCCAGCCTGCGGTCGCGC
GCAATCAGTAACAAGAGGATGCTTCGCGAGATTGTCAATCATGCGCCTCGTCGGCAGCAGCAGCCTTCGGTCGCT
CTCGAGCAGCTCCAGCGGCCGCCGAGCTCGTGCGAGACGCTGCCCCGCGAGACGGTCGTCGATCGATTATCAACA
GCCGCCGCCAGAGTCGTGGGCCACTTGGCTGCCATCTGTCTATACTGGGCCTGCATCGCCGTCTGGCTCGGCTTC
GGCCCTTTCTGCGACTGGAGCAACGGCTGGCAGCTCGCCATCAACTCCGCCACGTCGGCTCTCATGGTCTTCATC
TTCGCCTTTCTGGCCAACGTTCAGGAACGACATGCGGTTCACGTCCAACGCTGTCTGCAGGCCATCTTCGAGCAC
GACTCGGCCGTGGAGCGGGCCTTGCGCGCTATGACAGGCGACGATGTGGCTAACGAGACAGTCGTCGTCCTCGCG
CCCCGGATGAGCAGGATCCAGAGGGTCATCTTATACTACGCCGACCTCGTCGGCACCCTCACCGGCATCGCCATC
CTGACGGCCGTCATGGTCGTCTGGCTGGCCATTGGGCCCGTCATGGGCTTCAGCTCCAACTGGTGGCTTCTCATC
GGCACATATGCTGGCCTGGTCGGCCTCAACGACAGCTTTGTTCTGCGCAACGTCCAGATGCTCTTCAATGGCTAC
GCGCAGGAGGCTCTGGATCAGGTCGATCTCGACGACCAATCCATCTTCGATCAGCTCCGCCTGTCGGACCCTGCG
AAAGCACCCGTCCAGGCCGAGTCGCTCAGCTACCGAATCTCAGCCTGGATGGGCATCGTCTGCGCACACGAGGCT
ACTGTCATTGTCGGATTCATCTTCATTCTTGGTCTGCTCGCCGGTGCCACGGCCATGGGATGGTCTACAGCTGGG
CAGCTGCTGTGCAATATTCCGCCCAGCATCATCGAGACGTTTTTCATGATGATTCTCATCACGGGCCACAATCAG
GCCGAGACGAAGCGGCACGAGCGTCTTGAGAATTTCTTTCTTCGACGGTCGGTGCTGCTATCGTATGTGCAGAGA
CTTGAGGCTGGGCATTACACGATGCGTTCGGTACAAGATTCCTTGGACCATGTGGCT
Transcript >Ophio5|8107
ATGAAGCGCCTCATGGCATTGCTCGCGTCTTACGGAGCAAAGGGCCCCATCGAGCACACGGCTCCGACGCAACAT
GTCAAGGACGAGGAGACCAACGTCACGGGCTACGCCGACAAGGCCAAAGAGCGGGCACTAGACCGCTGGCTTGAC
CGTGTCGTCCAGGCATCCGGCTCGGAGCCCGTCTTCCTATTCATCGTTACCGGACTCGTCGTCTGGGCCTTTCTC
GGCATCCCGTACGGGCACACCGCTGACTGGGCCGTCCTGATATCCGATGTCCAGGCCATCGTCAGCTACGTCTTC
GACTCGCTGCTCATGCGTCAGCAGCTCAACGATTACGAGAAGATGGTGCGCGTCTCGGCCAGCCTGCGGTCGCGC
GCAATCAGTAACAAGAGGATGCTTCGCGAGATTGTCAATCATGCGCCTCGTCGGCAGCAGCAGCCTTCGGTCGCT
CTCGAGCAGCTCCAGCGGCCGCCGAGCTCGTGCGAGACGCTGCCCCGCGAGACGGTCGTCGATCGATTATCAACA
GCCGCCGCCAGAGTCGTGGGCCACTTGGCTGCCATCTGTCTATACTGGGCCTGCATCGCCGTCTGGCTCGGCTTC
GGCCCTTTCTGCGACTGGAGCAACGGCTGGCAGCTCGCCATCAACTCCGCCACGTCGGCTCTCATGGTCTTCATC
TTCGCCTTTCTGGCCAACGTTCAGGAACGACATGCGGTTCACGTCCAACGCTGTCTGCAGGCCATCTTCGAGCAC
GACTCGGCCGTGGAGCGGGCCTTGCGCGCTATGACAGGCGACGATGTGGCTAACGAGACAGTCGTCGTCCTCGCG
CCCCGGATGAGCAGGATCCAGAGGGTCATCTTATACTACGCCGACCTCGTCGGCACCCTCACCGGCATCGCCATC
CTGACGGCCGTCATGGTCGTCTGGCTGGCCATTGGGCCCGTCATGGGCTTCAGCTCCAACTGGTGGCTTCTCATC
GGCACATATGCTGGCCTGGTCGGCCTCAACGACAGCTTTGTTCTGCGCAACGTCCAGATGCTCTTCAATGGCTAC
GCGCAGGAGGCTCTGGATCAGGTCGATCTCGACGACCAATCCATCTTCGATCAGCTCCGCCTGTCGGACCCTGCG
AAAGCACCCGTCCAGGCCGAGTCGCTCAGCTACCGAATCTCAGCCTGGATGGGCATCGTCTGCGCACACGAGGCT
ACTGTCATTGTCGGATTCATCTTCATTCTTGGTCTGCTCGCCGGTGCCACGGCCATGGGATGGTCTACAGCTGGG
CAGCTGCTGTGCAATATTCCGCCCAGCATCATCGAGACGTTTTTCATGATGATTCTCATCACGGGCCACAATCAG
GCCGAGACGAAGCGGCACGAGCGTCTTGAGAATTTCTTTCTTCGACGGTCGGTGCTGCTATCGTATGTGCAGAGA
CTTGAGGCTGGGCATTACACGATGCGTTCGGTACAAGATTCCTTGGACCATGTGGCTTGA
Gene >Ophio5|8107
ATGAAGCGCCTCATGGCATTGCTCGCGTCTTACGGAGCAAAGGGCCCCATCGAGCACACGGCTCCGACGCAACAT
GTCAAGGACGAGGAGACCAACGTCACGGGCTACGCCGACAAGGCCAAAGAGCGGGCACTAGACCGCTGGCTTGAC
CGTGTCGTCCAGGCATCCGGCTCGGAGCCCGTCTTCCTATTCATCGTTACCGGACTCGTCGTCTGGGCCTTTCTC
GGCATCCCGTACGGGCACACCGCTGACTGGGCCGTCCTGATATCCGATGTCCAGGCCATCGTCAGCTACGTCTTC
GACTCGCTGCTCATGCGTCAGCAGCTCAACGATTACGAGAAGATGGTGCGCGTCTCGGCCAGCCTGCGGTCGCGC
GCAATCAGTAACAAGAGGATGCTTCGCGAGATTGTCAATCATGCGCCTCGTCGGCAGCAGCAGCCTTCGGTCGCT
CTCGAGCAGCTCCAGCGGCCGCCGAGCTCGTGCGAGACGCTGCCCCGCGAGACGGTCGTCGATCGATTATCAACA
GCCGCCGCCAGAGTCGTGGGCCACTTGGCTGCCATCTGTCTATACTGGGCCTGCATCGCCGTCTGGCTCGGCTTC
GGCCCTTTCTGCGACTGGAGCAACGGCTGGCAGCTCGCCATCAACTCCGCCACGTCGGCTCTCATGGTCTTCATC
TTCGCCTTTCTGGCCAACGTTCAGGAACGACATGCGGTTCACGTCCAACGCTGTCTGCAGGCCATCTTCGAGCAC
GACTCGGCCGTGGAGCGGGCCTTGCGCGCTATGACAGGCGACGATGTGGCTAACGAGACAGTCGTCGTCCTCGCG
CCCCGGATGAGCAGGATCCAGAGGGTCATCTTATACTACGCCGACCTCGTCGGCACCCTCACCGGCATCGCCATC
CTGACGGCCGTCATGGTCGTCTGGCTGGCCATTGGGCCCGTCATGGGCTTCAGCTCCAACTGGTGGCTTCTCATC
GGCACATATGCTGGCCTGGTCGGCCTCAACGACAGCTTTGTTCTGCGCAACGTCCAGATGCTCTTCAATGGCTAC
GCGCAGGAGGCTCTGGATCAGGTCGATCTCGACGACCAATCCATCTTCGATCAGCTCCGCCTGTCGGACCCTGCG
AAAGCACCCGTCCAGGCCGAGTCGCTCAGCTACCGAATCTCAGCCTGGATGGGCATCGTCTGCGCACACGAGGCT
ACTGTCATTGTCGGATTCATCTTCATTCTTGGTCTGCTCGCCGGTGCCACGGCCATGGGATGGTCTACAGCTGGG
CAGCTGCTGTGCAATATTCCGCCCAGCATCATCGAGACGTTTTTCATGATGATTCTCATCACGGGCCACAATCAG
GCCGAGACGAAGCGGCACGAGCGTCTTGAGAATTTCTTTCTTCGACGGTCGGTGCTGCTATCGTATGTGCAGAGA
CTTGAGGCTGGGCATTACACGATGCGTTCGGTACAAGATTCCTTGGACCATGTGGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail