Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8095
Gene name
Locationscaffold_86:11425..11797
Strand+
Gene length (bp)372
Transcript length (bp)279
Coding sequence length (bp)276
Protein length (aa) 92

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.0871 0.1253 0.0155 0.0876 0.9353 0.0412 0.0627 0.0493 0.0593 0.0137

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6823
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2778
Ophiocordyceps australis map64 (Brazil) OphauB2|1930
Ophiocordyceps kimflemingae Ophio5|8095 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8095
MLRRSLRSPVRILPLRPGPAPQRRSFADSLGGPGGQQPPPSKPNGIDALRRNWMPIGGAALALVAAYAYFRSPEP
PVESRIKTQGSKPLGGR
Coding >Ophio5|8095
ATGCTCCGGCGCAGCCTCCGCTCCCCCGTCCGCATCCTCCCTCTCCGGCCCGGACCGGCCCCGCAGCGCCGCAGC
TTCGCCGACAGTCTCGGTGGACCCGGTGGCCAGCAGCCGCCGCCGTCCAAGCCAAATGGCATCGACGCCCTCCGT
CGAAACTGGATGCCCATCGGTGGCGCTGCTCTCGCCCTCGTCGCAGCATACGCCTACTTTAGATCGCCCGAGCCG
CCGGTCGAGAGCAGAATCAAGACCCAGGGATCCAAGCCGTTGGGAGGGAGA
Transcript >Ophio5|8095
ATGCTCCGGCGCAGCCTCCGCTCCCCCGTCCGCATCCTCCCTCTCCGGCCCGGACCGGCCCCGCAGCGCCGCAGC
TTCGCCGACAGTCTCGGTGGACCCGGTGGCCAGCAGCCGCCGCCGTCCAAGCCAAATGGCATCGACGCCCTCCGT
CGAAACTGGATGCCCATCGGTGGCGCTGCTCTCGCCCTCGTCGCAGCATACGCCTACTTTAGATCGCCCGAGCCG
CCGGTCGAGAGCAGAATCAAGACCCAGGGATCCAAGCCGTTGGGAGGGAGATGA
Gene >Ophio5|8095
ATGCTCCGGCGCAGCCTCCGCTCCCCCGTCCGCATCCTCCCTCTCCGGCCCGGACCGGCCCCGCAGCGCCGCAGC
TTCGCCGACAGTCTCGGTGGACCCGGTGGCCAGCAGCCGCCGCCGTCCAAGCCAAATGGCATCGACGCCCTCCGT
CGAAACTGGTGACGCCGACTTTCTACATTCCTGACGCTTATCTCTTTCCCCGCTGGTCTCCGCTGACCTCCTGAA
AATCCCCCCCCCCTCCACCCTTTCAGGATGCCCATCGGTGGCGCTGCTCTCGCCCTCGTCGCAGCATACGCCTAC
TTTAGATCGCCCGAGCCGCCGGTCGAGAGCAGAATCAAGACCCAGGGATCCAAGCCGTTGGGAGGGAGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail