Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8092
Gene name
Locationscaffold_86:6608..7065
Strand+
Gene length (bp)457
Transcript length (bp)264
Coding sequence length (bp)261
Protein length (aa) 87

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10281 Ish1 Putative nuclear envelope organisation protein 3.1E-06 48 78

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.5

Transmembrane Domains

Domain # Start End Length
1 13 35 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 71.70 20.89 122.51
CcL In ants, during behavior modification 31.86 4.46 59.26
CcD In ants, recently dead 26.62 3.44 49.80

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.042059 yes
SC16a CcD 0.013983 yes
CcL CcD 0.727764 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8092
MPTHLDNALKSKNMVLAFGGMVAAAAAWTIWGGSLFPTEPDPTGDAQTWTREEMRRWLAARGLMPQQGDSRDQLL
ERVLANMRHPRR
Coding >Ophio5|8092
ATGCCGACGCACCTAGATAACGCTCTCAAGTCCAAGAACATGGTGCTGGCTTTCGGCGGCATGGTGGCCGCAGCC
GCAGCATGGACCATCTGGGGCGGAAGCCTCTTCCCGACCGAGCCGGATCCCACAGGAGATGCGCAGACGTGGACG
CGCGAGGAGATGCGGCGCTGGTTGGCGGCTAGGGGACTGATGCCGCAGCAAGGAGACTCGAGGGATCAGTTGTTG
GAGCGGGTCCTGGCTAACATGAGACATCCCCGGCGG
Transcript >Ophio5|8092
ATGCCGACGCACCTAGATAACGCTCTCAAGTCCAAGAACATGGTGCTGGCTTTCGGCGGCATGGTGGCCGCAGCC
GCAGCATGGACCATCTGGGGCGGAAGCCTCTTCCCGACCGAGCCGGATCCCACAGGAGATGCGCAGACGTGGACG
CGCGAGGAGATGCGGCGCTGGTTGGCGGCTAGGGGACTGATGCCGCAGCAAGGAGACTCGAGGGATCAGTTGTTG
GAGCGGGTCCTGGCTAACATGAGACATCCCCGGCGGTAA
Gene >Ophio5|8092
ATGCCGACGCACCTAGATAACGCTCTCAAGTCCAAGGTAAAAAAGAAGAAAAAAAAAGAAAAAAAAAAAAAAACC
CTCGTTCCCTCTTCATGCCCATTCTAATCTCACATCGACAGAACATGGTGCTGGGTGGGGACATCCGTCTCCGAA
GCCTCGCAGACGGGCGCCGACTGACGCGTGAGAACAAACAGCTTTCGGCGGCATGGTGGCCGCAGCCGCAGCATG
GACCATCTGGGGCGGAAGCCTCTTCCCGACCGAGCCGGATCCCACAGGAGATGCGCAGACGTGGACGCGCGAGGA
GATGCGGCGCTGGTTGGCGGCTGTAAGTGTTTGGACGTGCGTGGGAGGTGCCCCAGCGACTAACACCTGGTAGAG
GGGACTGATGCCGCAGCAAGGAGACTCGAGGGATCAGTTGTTGGAGCGGGTCCTGGCTAACATGAGACATCCCCG
GCGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail