Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8087
Gene name
Locationscaffold_859:4904..6257
Strand-
Gene length (bp)1353
Transcript length (bp)672
Coding sequence length (bp)669
Protein length (aa) 223

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00098 zf-CCHC Zinc knuckle 1.1E-07 69 84
PF00098 zf-CCHC Zinc knuckle 1.6E-08 90 106
PF00098 zf-CCHC Zinc knuckle 2.2E-09 113 128
PF00098 zf-CCHC Zinc knuckle 4.5E-08 142 157
PF00098 zf-CCHC Zinc knuckle 1.4E-05 175 190
PF13917 zf-CCHC_3 Zinc knuckle 4.2E-02 110 128
PF13917 zf-CCHC_3 Zinc knuckle 1.8E-01 138 156
PF13917 zf-CCHC_3 Zinc knuckle 5.9E-02 172 192
PF14392 zf-CCHC_4 Zinc knuckle 1.3E-02 67 84
PF14392 zf-CCHC_4 Zinc knuckle 1.6E+00 91 105
PF14392 zf-CCHC_4 Zinc knuckle 1.1E+00 112 128
PF14392 zf-CCHC_4 Zinc knuckle 4.4E-01 142 157
PF14392 zf-CCHC_4 Zinc knuckle 3.3E+00 176 190

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P36627|BYR3_SCHPO Cellular nucleic acid-binding protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr3 PE=3 SV=1 70 199 4.0E-31
sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 70 190 3.0E-26
sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 64 222 4.0E-26
sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 69 194 9.0E-26
sp|O42395|CNBP_CHICK Cellular nucleic acid-binding protein OS=Gallus gallus GN=CNBP PE=2 SV=1 70 191 3.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P36627|BYR3_SCHPO Cellular nucleic acid-binding protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr3 PE=3 SV=1 70 199 4.0E-31
sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 70 190 3.0E-26
sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 64 222 4.0E-26
sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 69 194 9.0E-26
sp|O42395|CNBP_CHICK Cellular nucleic acid-binding protein OS=Gallus gallus GN=CNBP PE=2 SV=1 70 191 3.0E-24
sp|P53996|CNBP_MOUSE Cellular nucleic acid-binding protein OS=Mus musculus GN=Cnbp PE=1 SV=2 70 191 3.0E-24
sp|Q3T0Q6|CNBP_BOVIN Cellular nucleic acid-binding protein OS=Bos taurus GN=CNBP PE=2 SV=1 70 191 3.0E-23
sp|P62634|CNBP_RAT Cellular nucleic acid-binding protein OS=Rattus norvegicus GN=Cnbp PE=2 SV=1 70 191 3.0E-23
sp|Q5R5R5|CNBP_PONAB Cellular nucleic acid-binding protein OS=Pongo abelii GN=CNBP PE=2 SV=1 70 191 3.0E-23
sp|P62633|CNBP_HUMAN Cellular nucleic acid-binding protein OS=Homo sapiens GN=CNBP PE=1 SV=1 70 191 3.0E-23
sp|O65639|CSP1_ARATH Cold shock protein 1 OS=Arabidopsis thaliana GN=CSP1 PE=1 SV=1 70 212 7.0E-23
sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 70 190 2.0E-22
sp|O42395|CNBP_CHICK Cellular nucleic acid-binding protein OS=Gallus gallus GN=CNBP PE=2 SV=1 68 213 7.0E-22
sp|Q8T8R1|Y3800_DROME CCHC-type zinc finger protein CG3800 OS=Drosophila melanogaster GN=CG3800 PE=1 SV=1 63 190 1.0E-21
sp|P53849|GIS2_YEAST Zinc finger protein GIS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIS2 PE=1 SV=1 66 199 7.0E-21
sp|O65639|CSP1_ARATH Cold shock protein 1 OS=Arabidopsis thaliana GN=CSP1 PE=1 SV=1 70 190 2.0E-20
sp|P53996|CNBP_MOUSE Cellular nucleic acid-binding protein OS=Mus musculus GN=Cnbp PE=1 SV=2 68 213 4.0E-20
sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 70 158 6.0E-20
sp|O65639|CSP1_ARATH Cold shock protein 1 OS=Arabidopsis thaliana GN=CSP1 PE=1 SV=1 70 156 2.0E-19
sp|Q3T0Q6|CNBP_BOVIN Cellular nucleic acid-binding protein OS=Bos taurus GN=CNBP PE=2 SV=1 68 213 4.0E-19
sp|P62634|CNBP_RAT Cellular nucleic acid-binding protein OS=Rattus norvegicus GN=Cnbp PE=2 SV=1 68 213 3.0E-18
sp|Q5R5R5|CNBP_PONAB Cellular nucleic acid-binding protein OS=Pongo abelii GN=CNBP PE=2 SV=1 68 213 3.0E-18
sp|P62633|CNBP_HUMAN Cellular nucleic acid-binding protein OS=Homo sapiens GN=CNBP PE=1 SV=1 68 213 3.0E-18
sp|P53849|GIS2_YEAST Zinc finger protein GIS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIS2 PE=1 SV=1 59 190 3.0E-18
sp|Q8WW36|ZCH13_HUMAN Zinc finger CCHC domain-containing protein 13 OS=Homo sapiens GN=ZCCHC13 PE=1 SV=1 62 190 1.0E-17
sp|P36627|BYR3_SCHPO Cellular nucleic acid-binding protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr3 PE=3 SV=1 69 191 3.0E-14
sp|O65639|CSP1_ARATH Cold shock protein 1 OS=Arabidopsis thaliana GN=CSP1 PE=1 SV=1 68 128 3.0E-13
sp|Q65XV7|RFA1C_ORYSJ Replication protein A 70 kDa DNA-binding subunit C OS=Oryza sativa subsp. japonica GN=RPA1C PE=1 SV=1 70 162 4.0E-13
sp|Q94C69|CSP3_ARATH Cold shock domain-containing protein 3 OS=Arabidopsis thaliana GN=CSP3 PE=1 SV=1 70 190 1.0E-12
sp|Q94C69|CSP3_ARATH Cold shock domain-containing protein 3 OS=Arabidopsis thaliana GN=CSP3 PE=1 SV=1 70 192 2.0E-12
sp|Q94C69|CSP3_ARATH Cold shock domain-containing protein 3 OS=Arabidopsis thaliana GN=CSP3 PE=1 SV=1 47 206 4.0E-12
sp|Q79666|POL_HV1MV Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group O (isolate MVP5180) GN=gag-pol PE=3 SV=3 86 191 1.0E-11
sp|Q8WW36|ZCH13_HUMAN Zinc finger CCHC domain-containing protein 13 OS=Homo sapiens GN=ZCCHC13 PE=1 SV=1 71 220 2.0E-11
sp|P05895|POL_SIVVT Gag-Pol polyprotein OS=Simian immunodeficiency virus agm.vervet (isolate AGM TYO-1) GN=gag-pol PE=3 SV=2 77 127 2.0E-11
sp|P27980|POL_SIVVG Gag-Pol polyprotein OS=Simian immunodeficiency virus agm.vervet (isolate AGM3) GN=gag-pol PE=3 SV=2 77 127 2.0E-11
sp|P53849|GIS2_YEAST Zinc finger protein GIS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIS2 PE=1 SV=1 41 128 4.0E-11
sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 101 215 7.0E-11
sp|Q966L9|GLH2_CAEEL ATP-dependent RNA helicase glh-2 OS=Caenorhabditis elegans GN=glh-2 PE=1 SV=1 90 195 1.0E-10
sp|Q65XV7|RFA1C_ORYSJ Replication protein A 70 kDa DNA-binding subunit C OS=Oryza sativa subsp. japonica GN=RPA1C PE=1 SV=1 85 190 2.0E-10
sp|O12158|POL_HV192 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype C (isolate 92BR025) GN=gag-pol PE=1 SV=2 69 127 3.0E-10
sp|P27973|POL_SIVV1 Gag-Pol polyprotein OS=Simian immunodeficiency virus agm.vervet (isolate AGM155) GN=gag-pol PE=3 SV=2 90 127 5.0E-10
sp|Q77373|POL_HV1AN Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group O (isolate ANT70) GN=gag-pol PE=3 SV=3 86 130 6.0E-10
sp|P04584|POL_HV2RO Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate ROD) GN=gag-pol PE=1 SV=3 62 164 8.0E-10
sp|Q9QBZ5|POL_HV1MP Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype F2 (isolate MP255) GN=gag-pol PE=3 SV=3 27 127 9.0E-10
sp|P34689|GLH1_CAEEL ATP-dependent RNA helicase glh-1 OS=Caenorhabditis elegans GN=glh-1 PE=1 SV=3 91 203 9.0E-10
sp|Q8T8R1|Y3800_DROME CCHC-type zinc finger protein CG3800 OS=Drosophila melanogaster GN=CG3800 PE=1 SV=1 69 132 1.0E-09
sp|O91080|POL_HV1YF Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group N (isolate YBF30) GN=gag-pol PE=3 SV=3 27 127 1.0E-09
sp|P24740|POL_HV1U4 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype A (isolate U455) GN=gag-pol PE=1 SV=3 62 127 1.0E-09
sp|P19505|POL_SIVSP Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate PBj14/BCL-3) GN=gag-pol PE=1 SV=2 62 179 1.0E-09
sp|Q966L9|GLH2_CAEEL ATP-dependent RNA helicase glh-2 OS=Caenorhabditis elegans GN=glh-2 PE=1 SV=1 69 138 2.0E-09
sp|Q1A249|POL_SIVEK Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate EK505) GN=gag-pol PE=3 SV=3 90 130 2.0E-09
sp|Q9QBZ9|POL_HV197 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype K (isolate 97ZR-EQTB11) GN=gag-pol PE=3 SV=2 26 127 2.0E-09
sp|Q75002|POL_HV1ET Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype C (isolate ETH2220) GN=gag-pol PE=3 SV=3 69 127 2.0E-09
sp|Q1A267|POL_SIVMB Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate MB66) GN=gag-pol PE=3 SV=4 86 127 4.0E-09
sp|O89940|POL_HV1SE Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype G (isolate SE6165) GN=gag-pol PE=3 SV=3 86 127 4.0E-09
sp|Q966L9|GLH2_CAEEL ATP-dependent RNA helicase glh-2 OS=Caenorhabditis elegans GN=glh-2 PE=1 SV=1 70 157 5.0E-09
sp|O76743|GLH4_CAEEL ATP-dependent RNA helicase glh-4 OS=Caenorhabditis elegans GN=glh-4 PE=1 SV=2 67 156 6.0E-09
sp|P24107|POL_HV2CA Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate CAM2) GN=gag-pol PE=3 SV=3 62 128 6.0E-09
sp|Q8N567|ZCHC9_HUMAN Zinc finger CCHC domain-containing protein 9 OS=Homo sapiens GN=ZCCHC9 PE=2 SV=2 81 190 7.0E-09
sp|P04587|POL_HV1B5 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BH5) GN=gag-pol PE=1 SV=3 62 127 7.0E-09
sp|Q9Q720|POL_HV1V9 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype H (isolate VI991) GN=gag-pol PE=3 SV=3 86 127 7.0E-09
sp|P18802|POL_HV1ND Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype D (isolate NDK) GN=gag-pol PE=3 SV=3 62 127 7.0E-09
sp|Q8R1J3|ZCHC9_MOUSE Zinc finger CCHC domain-containing protein 9 OS=Mus musculus GN=Zcchc9 PE=2 SV=2 81 190 9.0E-09
sp|P27978|GAG_SIVVG Gag polyprotein OS=Simian immunodeficiency virus agm.vervet (isolate AGM3) GN=gag PE=3 SV=1 88 127 1.0E-08
sp|P17283|POL_SIVCZ Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate CPZ GAB1) GN=gag-pol PE=3 SV=2 90 127 1.0E-08
sp|P0C6F2|POL_HV1LW Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate LW123) GN=gag-pol PE=1 SV=1 62 127 1.0E-08
sp|P03367|POL_HV1BR Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BRU/LAI) GN=gag-pol PE=1 SV=3 62 127 1.0E-08
sp|Q9IDV9|POL_HV1YB Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group N (isolate YBF106) GN=gag-pol PE=1 SV=3 90 127 1.0E-08
sp|P12497|POL_HV1N5 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate NY5) GN=gag-pol PE=1 SV=4 62 127 1.0E-08
sp|P20875|POL_HV1JR Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate JRCSF) GN=gag-pol PE=1 SV=3 27 127 1.0E-08
sp|P04588|POL_HV1MA Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype A (isolate MAL) GN=gag-pol PE=1 SV=3 90 127 1.0E-08
sp|Q02836|POL_SIVG1 Gag-Pol polyprotein OS=Simian immunodeficiency virus agm.grivet (isolate AGM gr-1) GN=gag-pol PE=3 SV=2 86 130 1.0E-08
sp|P20892|POL_HV1OY Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate OYI) GN=gag-pol PE=3 SV=3 62 127 1.0E-08
sp|Q9QBZ1|POL_HV1M2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype F2 (isolate MP257) GN=gag-pol PE=3 SV=3 90 127 1.0E-08
sp|O41798|POL_HV19N Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype G (isolate 92NG083) GN=gag-pol PE=3 SV=3 62 127 1.0E-08
sp|Q966L9|GLH2_CAEEL ATP-dependent RNA helicase glh-2 OS=Caenorhabditis elegans GN=glh-2 PE=1 SV=1 90 136 2.0E-08
sp|P35963|POL_HV1Y2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) GN=gag-pol PE=1 SV=3 62 127 2.0E-08
sp|Q73368|POL_HV1B9 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (strain 89.6) GN=gag-pol PE=3 SV=3 62 127 2.0E-08
sp|P03366|POL_HV1B1 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BH10) GN=gag-pol PE=1 SV=3 62 127 2.0E-08
sp|Q9QBY3|POL_HV196 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype K (isolate 96CM-MP535) GN=gag-pol PE=3 SV=3 90 127 2.0E-08
sp|P04585|POL_HV1H2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) GN=gag-pol PE=1 SV=4 62 127 2.0E-08
sp|P03369|POL_HV1A2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate ARV2/SF2) GN=gag-pol PE=1 SV=3 62 127 3.0E-08
sp|Q9QSR3|POL_HV1VI Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype F1 (isolate VI850) GN=gag-pol PE=3 SV=3 90 127 3.0E-08
sp|O93215|POL_HV190 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype H (isolate 90CF056) GN=gag-pol PE=3 SV=4 90 127 3.0E-08
sp|Q9WC63|POL_HV1S9 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype J (isolate SE9173) GN=gag-pol PE=3 SV=3 27 127 4.0E-08
sp|Q9WC54|POL_HV1S2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype J (isolate SE9280) GN=gag-pol PE=3 SV=3 27 127 4.0E-08
sp|P53996|CNBP_MOUSE Cellular nucleic acid-binding protein OS=Mus musculus GN=Cnbp PE=1 SV=2 59 129 5.0E-08
sp|Q3T0Q6|CNBP_BOVIN Cellular nucleic acid-binding protein OS=Bos taurus GN=CNBP PE=2 SV=1 59 129 5.0E-08
sp|P62634|CNBP_RAT Cellular nucleic acid-binding protein OS=Rattus norvegicus GN=Cnbp PE=2 SV=1 59 129 5.0E-08
sp|Q5R5R5|CNBP_PONAB Cellular nucleic acid-binding protein OS=Pongo abelii GN=CNBP PE=2 SV=1 59 129 5.0E-08
sp|P62633|CNBP_HUMAN Cellular nucleic acid-binding protein OS=Homo sapiens GN=CNBP PE=1 SV=1 59 129 5.0E-08
sp|Q82851|POL_JEMBR Gag-Pol polyprotein OS=Jembrana disease virus GN=gag-pol PE=3 SV=1 90 127 5.0E-08
sp|P04589|POL_HV1EL Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype D (isolate ELI) GN=gag-pol PE=3 SV=3 62 127 5.0E-08
sp|P12499|POL_HV1Z2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype D (isolate Z2/CDC-Z34) GN=gag-pol PE=1 SV=3 62 127 5.0E-08
sp|O42395|CNBP_CHICK Cellular nucleic acid-binding protein OS=Gallus gallus GN=CNBP PE=2 SV=1 59 129 6.0E-08
sp|Q79665|GAG_HV1MV Gag polyprotein OS=Human immunodeficiency virus type 1 group O (isolate MVP5180) GN=gag PE=3 SV=3 86 127 6.0E-08
sp|O76743|GLH4_CAEEL ATP-dependent RNA helicase glh-4 OS=Caenorhabditis elegans GN=glh-4 PE=1 SV=2 88 192 7.0E-08
sp|P12451|POL_HV2SB Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate SBLISY) GN=gag-pol PE=3 SV=3 62 128 7.0E-08
sp|P34689|GLH1_CAEEL ATP-dependent RNA helicase glh-1 OS=Caenorhabditis elegans GN=glh-1 PE=1 SV=3 86 136 8.0E-08
sp|O89290|POL_HV193 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype F1 (isolate 93BR020) GN=gag-pol PE=3 SV=3 90 127 8.0E-08
sp|Q82851|POL_JEMBR Gag-Pol polyprotein OS=Jembrana disease virus GN=gag-pol PE=3 SV=1 55 155 9.0E-08
sp|P05961|POL_HV1MN Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate MN) GN=gag-pol PE=1 SV=3 62 127 9.0E-08
sp|Q9QBZ6|GAG_HV1MP Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype F2 (isolate MP255) GN=gag PE=3 SV=2 27 127 9.0E-08
sp|P27972|GAG_SIVV1 Gag polyprotein OS=Simian immunodeficiency virus agm.vervet (isolate AGM155) GN=gag PE=3 SV=1 90 127 1.0E-07
sp|Q8AII1|POL_SIVTN Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate TAN1) GN=gag-pol PE=3 SV=4 86 127 1.0E-07
sp|Q77372|GAG_HV1AN Gag polyprotein OS=Human immunodeficiency virus type 1 group O (isolate ANT70) GN=gag PE=3 SV=3 86 127 1.0E-07
sp|O91079|GAG_HV1YF Gag polyprotein OS=Human immunodeficiency virus type 1 group N (isolate YBF30) GN=gag PE=3 SV=3 27 127 1.0E-07
sp|P34689|GLH1_CAEEL ATP-dependent RNA helicase glh-1 OS=Caenorhabditis elegans GN=glh-1 PE=1 SV=3 70 156 2.0E-07
sp|P24736|GAG_HV1U4 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype A (isolate U455) GN=gag PE=1 SV=3 27 127 2.0E-07
sp|P20876|POL_HV2ST Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate ST) GN=gag-pol PE=3 SV=3 90 146 2.0E-07
sp|P18096|POL_HV2BE Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate BEN) GN=gag-pol PE=3 SV=4 62 164 2.0E-07
sp|Q9QC00|GAG_HV197 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype K (isolate 97ZR-EQTB11) GN=gag PE=3 SV=2 26 127 2.0E-07
sp|P15833|POL_HV2D2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype B (isolate D205) GN=gag-pol PE=3 SV=3 86 128 2.0E-07
sp|P18042|POL_HV2G1 Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate Ghana-1) GN=gag-pol PE=1 SV=4 62 164 3.0E-07
sp|O12157|GAG_HV192 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype C (isolate 92BR025) GN=gag PE=3 SV=3 27 127 3.0E-07
sp|O76743|GLH4_CAEEL ATP-dependent RNA helicase glh-4 OS=Caenorhabditis elegans GN=glh-4 PE=1 SV=2 70 155 4.0E-07
sp|Q89928|POL_HV2EH Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype B (isolate EHO) GN=gag-pol PE=3 SV=3 62 128 4.0E-07
sp|P17757|POL_HV2D1 Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate D194) GN=gag-pol PE=3 SV=3 90 170 4.0E-07
sp|Q1A250|GAG_SIVEK Gag polyprotein OS=Simian immunodeficiency virus (isolate EK505) GN=gag PE=3 SV=3 90 127 4.0E-07
sp|P05897|POL_SIVMK Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate K6W) GN=gag-pol PE=1 SV=2 86 193 5.0E-07
sp|P12502|POL_SIVS4 Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate F236/smH4) GN=gag-pol PE=3 SV=2 90 166 5.0E-07
sp|P05892|GAG_SIVVT Gag polyprotein OS=Simian immunodeficiency virus agm.vervet (isolate AGM TYO-1) GN=gag PE=3 SV=1 88 127 5.0E-07
sp|Q8N567|ZCHC9_HUMAN Zinc finger CCHC domain-containing protein 9 OS=Homo sapiens GN=ZCCHC9 PE=2 SV=2 60 128 6.0E-07
sp|Q74120|POL_HV2KR Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate KR) GN=gag-pol PE=3 SV=3 90 128 6.0E-07
sp|P12498|POL_HV1J3 Gag-Pol polyprotein (Fragment) OS=Human immunodeficiency virus type 1 group M subtype B (isolate JH32) GN=gag-pol PE=3 SV=4 27 127 6.0E-07
sp|P05896|POL_SIVM1 Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate Mm142-83) GN=gag-pol PE=1 SV=2 86 128 7.0E-07
sp|P05959|POL_HV1RH Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate RF/HAT3) GN=gag-pol PE=1 SV=3 90 127 8.0E-07
sp|Q9IDV8|GAG_HV1YB Gag polyprotein OS=Human immunodeficiency virus type 1 group N (isolate YBF106) GN=gag PE=3 SV=3 27 127 1.0E-06
sp|O89939|GAG_HV1SE Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype G (isolate SE6165) GN=gag PE=3 SV=3 86 127 1.0E-06
sp|P12494|GAG_HV1J3 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate JH32) GN=gag PE=3 SV=3 27 127 1.0E-06
sp|Q1A268|GAG_SIVMB Gag polyprotein OS=Simian immunodeficiency virus (isolate MB66) GN=gag PE=3 SV=3 86 127 1.0E-06
sp|P17282|GAG_SIVCZ Gag polyprotein OS=Simian immunodeficiency virus (isolate CPZ GAB1) GN=gag PE=3 SV=1 86 127 1.0E-06
sp|Q8T8R1|Y3800_DROME CCHC-type zinc finger protein CG3800 OS=Drosophila melanogaster GN=CG3800 PE=1 SV=1 108 199 2.0E-06
sp|P27973|POL_SIVV1 Gag-Pol polyprotein OS=Simian immunodeficiency virus agm.vervet (isolate AGM155) GN=gag-pol PE=3 SV=2 70 104 2.0E-06
sp|Q8R1J3|ZCHC9_MOUSE Zinc finger CCHC domain-containing protein 9 OS=Mus musculus GN=Zcchc9 PE=2 SV=2 59 127 2.0E-06
sp|P20873|GAG_HV1JR Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate JRCSF) GN=gag PE=3 SV=3 27 127 2.0E-06
sp|Q75001|GAG_HV1ET Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype C (isolate ETH2220) GN=gag PE=3 SV=3 86 127 2.0E-06
sp|P05960|POL_HV1C4 Gag-Pol polyprotein (Fragment) OS=Human immunodeficiency virus type 1 group M subtype B (isolate CDC-451) GN=gag-pol PE=3 SV=3 27 127 2.0E-06
sp|P04594|GAG_HV1MA Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype A (isolate MAL) GN=gag PE=3 SV=3 27 127 2.0E-06
sp|Q9Q721|GAG_HV1V9 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype H (isolate VI991) GN=gag PE=3 SV=3 26 127 2.0E-06
sp|Q9QBZ2|GAG_HV1M2 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype F2 (isolate MP257) GN=gag PE=3 SV=2 89 127 2.0E-06
sp|Q70622|GAG_HV1LW Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate LW123) GN=gag PE=1 SV=3 27 127 2.0E-06
sp|P04593|GAG_HV1B5 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BH5) GN=gag PE=3 SV=3 27 127 2.0E-06
sp|P04590|GAG_HV2RO Gag polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate ROD) GN=gag PE=1 SV=3 43 133 3.0E-06
sp|P05887|GAG_HV1C4 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate CDC-451) GN=gag PE=3 SV=3 89 127 3.0E-06
sp|Q02843|GAG_SIVG1 Gag polyprotein OS=Simian immunodeficiency virus agm.grivet (isolate AGM gr-1) GN=gag PE=1 SV=1 27 130 3.0E-06
sp|P03348|GAG_HV1BR Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BRU/LAI) GN=gag PE=1 SV=3 27 127 3.0E-06
sp|Q9WC53|GAG_HV1S2 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype J (isolate SE9280) GN=gag PE=3 SV=3 27 127 3.0E-06
sp|Q9WC62|GAG_HV1S9 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype J (isolate SE9173) GN=gag PE=1 SV=3 27 127 3.0E-06
sp|P20889|GAG_HV1OY Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate OYI) GN=gag PE=3 SV=3 27 127 4.0E-06
sp|Q73367|GAG_HV1B9 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (strain 89.6) GN=gag PE=3 SV=3 27 127 4.0E-06
sp|P31821|GAG_FIVT2 Gag polyprotein OS=Feline immunodeficiency virus (isolate TM2) GN=gag PE=3 SV=1 62 140 4.0E-06
sp|P19504|GAG_SIVSP Gag polyprotein OS=Simian immunodeficiency virus (isolate PBj14/BCL-3) GN=gag PE=3 SV=1 43 133 4.0E-06
sp|O93182|GAG_HV190 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype H (isolate 90CF056) GN=gag PE=3 SV=3 89 127 4.0E-06
sp|Q9QBY4|GAG_HV196 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype K (isolate 96CM-MP535) GN=gag PE=3 SV=2 89 127 4.0E-06
sp|P12493|GAG_HV1N5 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate NY5) GN=gag PE=1 SV=3 27 127 4.0E-06
sp|Q9QSR4|GAG_HV1VI Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype F1 (isolate VI850) GN=gag PE=3 SV=3 89 127 4.0E-06
sp|P18800|GAG_HV1ND Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype D (isolate NDK) GN=gag PE=3 SV=3 27 127 4.0E-06
sp|Q8VYA5|RSZ33_ARATH Serine/arginine-rich splicing factor RS2Z33 OS=Arabidopsis thaliana GN=RS2Z33 PE=1 SV=1 62 127 4.0E-06
sp|P35962|GAG_HV1Y2 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) GN=gag PE=1 SV=2 27 127 5.0E-06
sp|P24106|GAG_HV2CA Gag polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate CAM2) GN=gag PE=3 SV=3 90 133 5.0E-06
sp|P69732|GAG_EIAVY Gag polyprotein OS=Equine infectious anemia virus (strain Wyoming) GN=gag PE=1 SV=1 84 127 6.0E-06
sp|P69731|GAG_EIAVC Gag polyprotein OS=Equine infectious anemia virus (isolate CL22) GN=gag PE=3 SV=1 84 127 6.0E-06
sp|P69730|GAG_EIAV9 Gag polyprotein OS=Equine infectious anemia virus (isolate 1369) GN=gag PE=1 SV=1 84 127 6.0E-06
sp|P0C1K7|GAG_HV19N Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype G (isolate 92NG083) GN=gag PE=3 SV=2 86 127 6.0E-06
sp|P04591|GAG_HV1H2 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) GN=gag PE=1 SV=3 27 127 7.0E-06
sp|Q9FYB7|RSZ32_ARATH Serine/arginine-rich splicing factor RS2Z32 OS=Arabidopsis thaliana GN=RS2Z32 PE=1 SV=1 62 127 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:0008270 zinc ion binding Yes
GO:0046914 transition metal ion binding No
GO:0046872 metal ion binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.5

Transmembrane Domains

Domain # Start End Length
1 38 60 22

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Zinc finger, CCHC-type

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 416.01 216.14 615.88
CcL In ants, during behavior modification 484.68 245.31 724.04
CcD In ants, recently dead 503.48 254.49 752.47

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.571623 no
SC16a CcD 0.470725 no
CcL CcD 0.901954 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8087
MFSFLTRSVKVVAGKPLAPSSSLASLLRPQSATTSMKFFWHRFFSLTIFLAVSTPSSLLVKTMDYTRGACYSCGS
TGHQARDCPTKGPAKCYNCGGEGHLSRDCPEPMKENKACYKCGQPGHISRDCPLGGGPPAGGQSTECYKCGEMGH
IARNCPKSSFGGGAFGGGGGGGAGKTCYSCGGYGHMSRECVNGMKCYNCVAGSQLALRGSWGSARPGCVMAGS
Coding >Ophio5|8087
ATGTTTTCGTTCTTGACTAGATCAGTCAAGGTGGTCGCTGGAAAACCGCTCGCCCCGTCTTCTTCTCTCGCCTCC
CTACTCCGTCCTCAGAGTGCGACAACCTCGATGAAATTTTTCTGGCATCGGTTCTTCTCGCTAACAATATTTCTG
GCAGTCTCAACACCTTCTTCCCTACTTGTCAAGACGATGGACTATACGCGCGGCGCATGCTATTCTTGCGGCTCC
ACCGGCCACCAGGCCCGTGATTGCCCGACCAAAGGCCCTGCCAAGTGCTACAACTGTGGCGGCGAAGGTCACCTC
AGTCGAGATTGCCCTGAGCCGATGAAGGAAAACAAAGCCTGCTACAAGTGCGGCCAGCCCGGCCACATCTCCCGT
GACTGCCCCCTGGGCGGTGGTCCCCCGGCTGGTGGCCAGTCAACTGAATGCTACAAGTGCGGCGAGATGGGACAC
ATCGCGCGGAACTGCCCCAAGTCTTCGTTTGGTGGCGGCGCTTTTGGCGGCGGCGGCGGCGGCGGCGCGGGCAAG
ACGTGCTATTCTTGCGGCGGCTATGGCCACATGTCCCGGGAATGTGTCAACGGTATGAAATGCTACAACTGCGTG
GCTGGCTCGCAACTCGCGTTGCGCGGATCTTGGGGATCAGCAAGACCGGGTTGTGTCATGGCGGGAAGT
Transcript >Ophio5|8087
ATGTTTTCGTTCTTGACTAGATCAGTCAAGGTGGTCGCTGGAAAACCGCTCGCCCCGTCTTCTTCTCTCGCCTCC
CTACTCCGTCCTCAGAGTGCGACAACCTCGATGAAATTTTTCTGGCATCGGTTCTTCTCGCTAACAATATTTCTG
GCAGTCTCAACACCTTCTTCCCTACTTGTCAAGACGATGGACTATACGCGCGGCGCATGCTATTCTTGCGGCTCC
ACCGGCCACCAGGCCCGTGATTGCCCGACCAAAGGCCCTGCCAAGTGCTACAACTGTGGCGGCGAAGGTCACCTC
AGTCGAGATTGCCCTGAGCCGATGAAGGAAAACAAAGCCTGCTACAAGTGCGGCCAGCCCGGCCACATCTCCCGT
GACTGCCCCCTGGGCGGTGGTCCCCCGGCTGGTGGCCAGTCAACTGAATGCTACAAGTGCGGCGAGATGGGACAC
ATCGCGCGGAACTGCCCCAAGTCTTCGTTTGGTGGCGGCGCTTTTGGCGGCGGCGGCGGCGGCGGCGCGGGCAAG
ACGTGCTATTCTTGCGGCGGCTATGGCCACATGTCCCGGGAATGTGTCAACGGTATGAAATGCTACAACTGCGTG
GCTGGCTCGCAACTCGCGTTGCGCGGATCTTGGGGATCAGCAAGACCGGGTTGTGTCATGGCGGGAAGTTGA
Gene >Ophio5|8087
ATGTTTTCGTTCTTGACTAGATCAGTCAAGGTGGTCGCTGGAAAACCGCTCGCCCCGTCTTCTTCTCTCGCCTCC
CTACTCCGTCCTCAGAGTGCGACAACCTCGATGAAATTTTTCTGGCATCGGTTCTTCTCGCTAACAATATTTCTG
GCAGTCTCAACACCTTCTTCCCTACTTGTCAAGACGATGGACTATACGCGCGGCGCATGCTATTCTTGTGAGTGC
CCTCCAACGCCGTCTCGACCGTTGGTCACCTCGTCGTTACTGACCATCTCTCAGGCGGCTCCACCGGCCACCAGG
TACGTTGACGGGCTGAGAATTTCTGGTCGCCTGACTCTTCTGACTGTTGGCAGGCCCGTGATTGCCCGACCAAAG
GCCCTGCCAAGTGGTGCGTCACACGTCCCTTCCCACATGATGAGCCTCTGCTAACCTGGCATAAAGCTACAACTG
TGGCGGTATGTTGCATTCTTCCCGAGCCCTCTCGTCCTCGACACCGTGCTAACTTACTTGCAGGCGAAGGTCACC
TCAGTCAGTTTCTGCCTCCATCCATCAACCCAATTGAGTGTCTACTGACCGGTTCTTAGGTCGAGATTGCCCTGA
GCCGATGAAGGAAAACAAAGCCTGCTACAAGTGCGGCCAGCCCGGCCACATCTCCCGTGACTGCCCCCTGGGCGG
TGGTCCCCCGGCTGGTGGCCAGTCAACTGAATGCTACAAGGTACGGCTCGCAAAGTCCGCGTTGTGCGTCGGCTG
ACGAGAGCAAACAGTGCGGCGAGATGGGACACATCGCGCGGAACTGCCCCAAGTCTTCGTTTGGTGGCGGCGCTT
TTGGCGGCGGCGGCGGCGGCGGCGCGGGCAAGACGTGCTATTCTTGCGGCGGCTATGGCCACATGTCCCGTAAGG
CGACCAAGACGGTACCCCGATTTCGGTGCGAAGCTGACCATGTCTTTTGTGCAGGGGAATGTGTCAACGGTATGA
AATGCTACAACTGCGGTGAGTCGGGCCACTACTCTCGCGACTGCCCCAAGGAATCGGCGGCTGGCGGCGAAAAGA
TCTGCTACAAGTGCCAGCAGTCCGGACACGTCCAGGCGCAGTGCCCCAACTAAACACAAGGCGGCCGTGTTCTCT
CTTGCTCAGCTGGAGAGGAAGTTGGCGTGGCAGCTCCATGATACCCACGACAAATCGCTTTACTTTGCATTTTTC
GGGTTTGGAAGCTTCTACAGAGTCTGACAAAAAGCTTTTTTTCTATTTTCCATCATGTACGATCGGCGGGACCAT
AAAGTGGCTGGCTCGCAACTCGCGTTGCGCGGATCTTGGGGATCAGCAAGACCGGGTTGTGTCATGGCGGGAAGT
TGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail