Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8085
Gene name
Locationscaffold_859:230..2085
Strand+
Gene length (bp)1855
Transcript length (bp)1695
Coding sequence length (bp)1692
Protein length (aa) 564

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04082 Fungal_trans Fungal specific transcription factor domain 2.1E-15 7 320

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0006351 transcription, DNA-templated Yes
GO:0008270 zinc ion binding Yes
GO:0003677 DNA binding Yes
GO:0046872 metal ion binding No
GO:0003674 molecular_function No
GO:0044237 cellular metabolic process No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0008152 metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0003676 nucleic acid binding No
GO:0090304 nucleic acid metabolic process No
GO:0044238 primary metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008150 biological_process No
GO:0019438 aromatic compound biosynthetic process No
GO:0016070 RNA metabolic process No
GO:0009058 biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0046914 transition metal ion binding No
GO:0097159 organic cyclic compound binding No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0097659 nucleic acid-templated transcription No
GO:0009059 macromolecule biosynthetic process No
GO:1901363 heterocyclic compound binding No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0032774 RNA biosynthetic process No
GO:0009987 cellular process No
GO:0043170 macromolecule metabolic process No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Fungal Specific TF

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8085
MVYSLVDLYFKHCNTWCPILDRKSTFAAFFGSTSLSEVDGILLQAIIATTLRFLKDARLTREMRAHYHAVSRHAV
IVYAMEHVSVAGLKALVILSLDELGTSDGPRAWNMLALLAQNVRHLHLQHETRTFLDLDIANHHHLHHLHHHHHV
ADARTAFAPGRPESWIEDEGRRRLCWMVYLLDRYATLATMTLDFMLDDGCMRRVLPCSYDLFSRNVPVETSGPNG
AVTKPENLGSFSYHCEMLRILSRVHAFLRQPIDSTSSSSSSSVSVSVSASSSSSSSSSSSSSSSPSASSTPASTS
LPSSVWRTTYRALDASLDNWLQNLPSEYSRISALCHSDPASRVANWFMLHSAYVTAVVRLHSAAAYPTTRTAALA
SPSHYAMQRCLSAVQSLRDITQDVYDANGLDLVGPPFAFALWVAARLLLVHAATVGGPVDAKVDFFIDMLACVGE
YWEVATSYATILARVVRRGRQGEASFSAMRRNAYDLAGLTSSTRRTGLEQASARAASAAELDCIEVFDFFNYPRP
SSEPAPPGLLLQRPGVDALSSAAVPDPDADWLGYSSSFG
Coding >Ophio5|8085
ATGGTCTACTCCTTAGTTGACCTCTACTTCAAACACTGCAACACCTGGTGTCCCATCCTCGACCGCAAATCCACC
TTTGCCGCCTTCTTCGGCTCAACCTCTCTAAGCGAAGTAGACGGAATCTTACTTCAAGCCATCATCGCCACCACG
CTTCGCTTCCTCAAAGATGCCAGACTCACGCGGGAGATGCGTGCACATTATCACGCCGTCTCTCGGCACGCCGTC
ATCGTATACGCCATGGAACACGTCAGCGTCGCCGGCTTGAAAGCTCTCGTCATCCTCTCCCTCGATGAATTGGGA
ACGTCGGATGGACCGCGTGCGTGGAATATGCTCGCCTTGTTGGCACAAAACGTTCGGCATTTACATCTTCAACAT
GAGACGCGTACTTTTCTCGACCTCGACATCGCCAATCATCATCATCTTCATCATCTTCATCATCATCATCATGTT
GCTGACGCTAGGACTGCTTTCGCCCCCGGTCGTCCCGAGTCTTGGATCGAGGATGAGGGCAGGAGGAGGCTTTGC
TGGATGGTTTATTTGCTGGATCGGTATGCGACCCTGGCGACGATGACGCTCGACTTTATGCTCGATGATGGTTGT
ATGCGTCGTGTTCTTCCTTGCTCATACGATCTCTTTTCGCGAAACGTCCCCGTCGAAACATCCGGACCAAACGGC
GCCGTCACCAAGCCCGAGAATCTCGGCAGTTTCTCCTATCATTGCGAGATGCTGCGTATCCTCAGTCGAGTACAC
GCCTTTCTCCGTCAACCCATTGATTCCACTTCATCCTCTTCTTCATCCTCCGTCTCCGTCTCCGTCTCCGCCTCC
TCCTCCTCCTCCTCATCATCATCATCATCTTCTTCTTCATCCCCCTCCGCATCATCAACTCCGGCATCCACCTCA
CTTCCATCCTCCGTCTGGCGAACCACATACCGCGCCCTCGACGCCTCCCTCGACAACTGGCTGCAGAATCTTCCC
AGCGAATACAGTCGAATCTCTGCCCTCTGCCACTCCGATCCAGCCAGCCGCGTAGCAAACTGGTTCATGCTGCAC
AGCGCCTATGTCACCGCCGTCGTACGTCTCCATTCTGCTGCCGCCTATCCGACCACGCGGACGGCTGCGTTGGCT
TCGCCGTCGCACTACGCCATGCAGCGCTGCCTATCTGCTGTTCAGAGCCTGAGAGACATCACACAGGATGTCTAC
GACGCCAATGGTCTCGATCTCGTCGGACCGCCTTTCGCCTTTGCTCTTTGGGTTGCCGCGCGTCTTCTGCTGGTG
CATGCTGCTACCGTCGGAGGACCCGTGGATGCCAAGGTCGACTTCTTCATTGACATGCTTGCTTGTGTGGGCGAG
TACTGGGAAGTTGCCACTTCTTATGCCACCATCTTGGCCAGAGTCGTGAGGCGCGGTCGCCAGGGAGAGGCGAGC
TTCTCGGCCATGCGGAGAAACGCATACGACCTCGCCGGTTTAACCTCCTCAACCCGCCGCACCGGCCTCGAACAA
GCCTCAGCCCGTGCCGCCTCTGCTGCCGAACTCGACTGCATCGAAGTCTTCGACTTCTTCAACTACCCGCGGCCT
TCGTCCGAGCCAGCACCTCCGGGCCTGCTTCTCCAGCGTCCGGGCGTCGACGCTCTCTCCAGCGCCGCCGTGCCG
GACCCGGATGCCGACTGGCTTGGGTACAGCTCGTCTTTTGGC
Transcript >Ophio5|8085
ATGGTCTACTCCTTAGTTGACCTCTACTTCAAACACTGCAACACCTGGTGTCCCATCCTCGACCGCAAATCCACC
TTTGCCGCCTTCTTCGGCTCAACCTCTCTAAGCGAAGTAGACGGAATCTTACTTCAAGCCATCATCGCCACCACG
CTTCGCTTCCTCAAAGATGCCAGACTCACGCGGGAGATGCGTGCACATTATCACGCCGTCTCTCGGCACGCCGTC
ATCGTATACGCCATGGAACACGTCAGCGTCGCCGGCTTGAAAGCTCTCGTCATCCTCTCCCTCGATGAATTGGGA
ACGTCGGATGGACCGCGTGCGTGGAATATGCTCGCCTTGTTGGCACAAAACGTTCGGCATTTACATCTTCAACAT
GAGACGCGTACTTTTCTCGACCTCGACATCGCCAATCATCATCATCTTCATCATCTTCATCATCATCATCATGTT
GCTGACGCTAGGACTGCTTTCGCCCCCGGTCGTCCCGAGTCTTGGATCGAGGATGAGGGCAGGAGGAGGCTTTGC
TGGATGGTTTATTTGCTGGATCGGTATGCGACCCTGGCGACGATGACGCTCGACTTTATGCTCGATGATGGTTGT
ATGCGTCGTGTTCTTCCTTGCTCATACGATCTCTTTTCGCGAAACGTCCCCGTCGAAACATCCGGACCAAACGGC
GCCGTCACCAAGCCCGAGAATCTCGGCAGTTTCTCCTATCATTGCGAGATGCTGCGTATCCTCAGTCGAGTACAC
GCCTTTCTCCGTCAACCCATTGATTCCACTTCATCCTCTTCTTCATCCTCCGTCTCCGTCTCCGTCTCCGCCTCC
TCCTCCTCCTCCTCATCATCATCATCATCTTCTTCTTCATCCCCCTCCGCATCATCAACTCCGGCATCCACCTCA
CTTCCATCCTCCGTCTGGCGAACCACATACCGCGCCCTCGACGCCTCCCTCGACAACTGGCTGCAGAATCTTCCC
AGCGAATACAGTCGAATCTCTGCCCTCTGCCACTCCGATCCAGCCAGCCGCGTAGCAAACTGGTTCATGCTGCAC
AGCGCCTATGTCACCGCCGTCGTACGTCTCCATTCTGCTGCCGCCTATCCGACCACGCGGACGGCTGCGTTGGCT
TCGCCGTCGCACTACGCCATGCAGCGCTGCCTATCTGCTGTTCAGAGCCTGAGAGACATCACACAGGATGTCTAC
GACGCCAATGGTCTCGATCTCGTCGGACCGCCTTTCGCCTTTGCTCTTTGGGTTGCCGCGCGTCTTCTGCTGGTG
CATGCTGCTACCGTCGGAGGACCCGTGGATGCCAAGGTCGACTTCTTCATTGACATGCTTGCTTGTGTGGGCGAG
TACTGGGAAGTTGCCACTTCTTATGCCACCATCTTGGCCAGAGTCGTGAGGCGCGGTCGCCAGGGAGAGGCGAGC
TTCTCGGCCATGCGGAGAAACGCATACGACCTCGCCGGTTTAACCTCCTCAACCCGCCGCACCGGCCTCGAACAA
GCCTCAGCCCGTGCCGCCTCTGCTGCCGAACTCGACTGCATCGAAGTCTTCGACTTCTTCAACTACCCGCGGCCT
TCGTCCGAGCCAGCACCTCCGGGCCTGCTTCTCCAGCGTCCGGGCGTCGACGCTCTCTCCAGCGCCGCCGTGCCG
GACCCGGATGCCGACTGGCTTGGGTACAGCTCGTCTTTTGGCTAG
Gene >Ophio5|8085
ATGGTCTACTCCTTAGTTGACCTCTACTTCAAACACTGCAACACCTGGTGTCCCATCCTCGACCGCAAATCCACC
TTTGCCGCCTTCTTCGGCTCAACCTCTCTAAGCGAAGTAGACGGAATCTTACTTCAAGCCATCATCGCCACCACG
CTTCGCTTCCTCAAAGATGCCAGACTCACGCGGGAGATGCGTGCACATTATCACGCCGTCTCTCGGCACGCCGTC
ATCGTATACGCCATGGAACACGTCAGCGTCGCCGGCTTGAAAGCTCTCGTCATCCTCTCCCTCGATGAATTGGGA
ACGTCGGATGGACCGCGTGCGTGGAATATGCTCGCCTTGTTGGCACAAAACGTTCGGCATTTACATCTTCAACAT
GAGACGCGTACTTTTCTCGACCTCGACATCGCCAATCATCATCATCTTCATCATCTTCATCATCATCATCATGTT
GCTGACGCTAGGACTGCTTTCGCCCCCGGTCGTCCCGAGTCTTGGATCGAGGATGAGGGCAGGAGGAGGCTTTGC
TGGATGGTTTATTTGCTGGATCGGTATGCGACCCTGGCGACGATGACGCTCGACTTTATGCTCGATGATGGTTGT
ATGCGTCGTGTTCTTCCTTGCTCATACGATCTCTTTTCGCGAAACGTCCCCGTCGAAACATCCGGACCAAACGGC
GCCGTCACCAAGCCCGAGAATCTCGGCAGTTTCTCCTATCATTGCGAGATGCTGCGTATCCTCAGTCGAGTACAC
GCCTTTCTCCGTCAACCCATTGATTCCACTTCATCCTCTTCTTCATCCTCCGTCTCCGTCTCCGTCTCCGCCTCC
TCCTCCTCCTCCTCATCATCATCATCATCTTCTTCTTCATCCCCCTCCGCATCATCAACTCCGGCATCCACCTCA
CTTCCATCCTCCGTCTGGCGAACCACATACCGCGCCCTCGACGCCTCCCTCGACAACTGGCTGCAGAATCTTCCC
AGCGAATACAGTCGAATCTCTGCCCTCTGCCACTCCGATCCAGCCAGCCGCGTAGCAAACTGGTTCATGCTGCAC
AGCGCCTATGTCACCGCCGTCGTACGTCTCCATTCTGCTGCCGCCTATCCGACCACGCGGACGGCTGCGTTGGCT
TCGCCGTCGCACTACGCCATGCAGCGCTGCCTATCTGCTGTTCAGAGCCTGAGAGACATCACACAGGATGTCTAC
GACGCCAATGGTCTCGATCTCGTCGGACCGCCTTTCGCCTTTGCTCTTTGGGTTGCCGCGCGTCTTCTGCTGGTG
CATGCTGCTACCGTCGGAGGACCCGTGGATGCCAAGGTCGACTTCTTCATTGACATGCTTGCTTGTGTGGGCGAG
TACTGGGAAGTTGCCACTTCTTATGCCACCATCTTGGCCAGAGTCGTGAGGCGCGGTCGCCAGGGAGAGGCGAGC
TTCTCGGCCATGCGGAGGTGCGTATAGCGCCCGCCTTTCTTTTCCCCTTGCCGTCTTCCTTGTTCCGATGTCATC
ATCTTTCTCCCCTTGTCGTCTTCTTTGTCCGTTGTAATCGTCTTTTCTCTCTGTTCGTCGTCCCTTCCCCCCCCC
CCCATCACTAACACTCCGACCCCCAAGAAACGCATACGACCTCGCCGGTTTAACCTCCTCAACCCGCCGCACCGG
CCTCGAACAAGCCTCAGCCCGTGCCGCCTCTGCTGCCGAACTCGACTGCATCGAAGTCTTCGACTTCTTCAACTA
CCCGCGGCCTTCGTCCGAGCCAGCACCTCCGGGCCTGCTTCTCCAGCGTCCGGGCGTCGACGCTCTCTCCAGCGC
CGCCGTGCCGGACCCGGATGCCGACTGGCTTGGGTACAGCTCGTCTTTTGGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail