Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|808
Gene name
Locationscaffold_123:798..2621
Strand+
Gene length (bp)1823
Transcript length (bp)1614
Coding sequence length (bp)1611
Protein length (aa) 537

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00999 Na_H_Exchanger Sodium/hydrogen exchanger family 6.6E-51 22 452

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q99271|NAH1_YEAST Na(+)/H(+) antiporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NHA1 PE=1 SV=1 11 457 3.0E-86
sp|O14123|NAH2_SCHPO Probable Na(+)/H(+) antiporter C3A11.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sod22 PE=1 SV=1 11 457 5.0E-85
sp|O42701|NAH2_ZYGRO Na(+)/H(+) antiporter 2 OS=Zygosaccharomyces rouxii GN=SOD22 PE=3 SV=1 11 460 9.0E-82
sp|Q99173|NAH1_ZYGRO Na(+)/H(+) antiporter 1 OS=Zygosaccharomyces rouxii GN=SOD2 PE=3 SV=1 11 457 2.0E-81
sp|P36606|NAH_SCHPO Na(+)/H(+) antiporter OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sod2 PE=1 SV=1 11 474 7.0E-61

GO

GO Term Description Terminal node
GO:0006812 cation transport Yes
GO:0015299 solute:proton antiporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0008150 biological_process No
GO:0022857 transmembrane transporter activity No
GO:0022804 active transmembrane transporter activity No
GO:0015297 antiporter activity No
GO:0031224 intrinsic component of membrane No
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0015298 solute:cation antiporter activity No
GO:0005575 cellular_component No
GO:0015291 secondary active transmembrane transporter activity No
GO:0006811 ion transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.5

Transmembrane Domains

Domain # Start End Length
1 13 35 22
2 45 64 19
3 122 144 22
4 149 171 22
5 192 214 22
6 229 251 22
7 271 290 19
8 342 364 22
9 385 407 22
10 432 454 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|808
MADNKVWVIPLELSNYNVIVALLGGFISLFGLVSFLLKENFYLSEALISLLAGLAFGPLGANFIRPRAYSECNQS
GVSDIECEDNLNSITLNFSRLVLAVQLVLAGVQLPSKYLWKELKPVLLLIGPGMICMWLATSLLVWGLAGTPSFL
QALAVGACVTPTDPVLSAVIVKGKFADENIPKDLQNLIIAESGVNDGLGYPFLFLALYLIKYIGSGSSSGGVREA
IGLWFAITWAYTILLSIVFGAVVGWIAKELLHWAEERNYVDRESFLIFSIALALFVLGTCGLIGTDDLLACFIAG
NTFTWDDWFRVQTQDDSLQPTIDMLLNVSIFLWYGASLPWGLFGHNAVISTGRLVALGFLVLLLRRLPWVFCMHR
WIGQIEDVTQAIFVGFFGPIGVSAVFYLLICLNFIEDHLSDENGQARNDVTNFGETIRVIVWFLVVCSTVVHGLS
IPLGKMGYLAPRKIGRVVSRSLSDEPRMVQARVKMPVIDVQSSRAIHLASDEQRQAESSADGSGTATPARQEREI
QFSDEIDAGHND
Coding >Ophio5|808
ATGGCGGATAACAAGGTTTGGGTAATTCCACTGGAGTTGTCCAACTACAACGTCATCGTGGCCCTGCTGGGCGGC
TTCATCTCGCTCTTTGGCTTGGTTTCCTTTCTGTTGAAGGAGAACTTCTATCTCTCGGAAGCTCTCATCTCTCTC
TTGGCGGGCCTCGCCTTTGGTCCGCTGGGCGCAAACTTCATTCGACCCAGGGCCTATTCCGAGTGCAACCAGAGC
GGTGTGTCGGATATCGAGTGCGAGGATAACCTAAATAGCATCACCCTCAACTTCTCTCGCCTCGTCCTCGCCGTT
CAGCTCGTCCTCGCGGGGGTCCAACTTCCTAGCAAATACCTATGGAAAGAACTGAAGCCTGTCTTGTTACTCATC
GGGCCTGGCATGATATGCATGTGGCTCGCCACCAGTCTTCTCGTCTGGGGCCTCGCGGGCACGCCTAGCTTCCTG
CAAGCCCTGGCCGTCGGGGCGTGTGTCACGCCTACGGATCCTGTCCTATCGGCCGTGATTGTCAAGGGCAAATTT
GCCGACGAGAATATACCCAAGGACCTCCAAAACCTTATCATAGCGGAATCGGGTGTCAACGATGGGCTCGGCTAC
CCGTTCTTGTTCCTCGCCCTCTACCTCATCAAGTATATCGGCTCCGGATCCTCGTCCGGTGGCGTGAGGGAGGCC
ATCGGTCTCTGGTTCGCGATAACCTGGGCGTATACAATACTGCTCAGCATCGTATTCGGCGCTGTGGTGGGATGG
ATAGCCAAGGAGCTGCTTCACTGGGCCGAGGAGCGCAACTACGTCGATCGCGAAAGCTTTCTCATCTTCTCTATT
GCGCTCGCCCTGTTTGTACTAGGGACCTGTGGCCTGATTGGAACCGATGATCTTCTCGCCTGCTTCATCGCCGGT
AATACGTTTACGTGGGACGATTGGTTCCGCGTGCAGACCCAAGACGACTCTCTCCAGCCGACGATCGATATGCTA
CTCAACGTATCCATCTTCCTCTGGTACGGCGCGTCCCTCCCCTGGGGCCTCTTTGGTCACAACGCCGTCATCTCT
ACCGGGCGACTCGTCGCTCTCGGCTTCCTCGTGCTGCTTCTCAGGCGATTGCCGTGGGTCTTTTGTATGCATAGG
TGGATCGGCCAGATCGAAGACGTCACGCAAGCCATTTTCGTCGGTTTCTTCGGACCCATTGGTGTCTCGGCCGTC
TTTTATCTACTAATCTGCCTGAATTTCATCGAGGATCATCTGAGCGACGAGAATGGACAGGCAAGAAACGACGTG
ACGAATTTTGGCGAAACTATTCGTGTCATCGTCTGGTTTCTCGTTGTTTGTAGCACTGTTGTTCATGGACTCAGC
ATTCCGCTCGGCAAGATGGGATACCTGGCACCGAGAAAGATTGGGCGTGTTGTGAGTCGGAGTTTGAGTGATGAG
CCACGCATGGTGCAGGCTCGAGTCAAGATGCCCGTCATAGATGTTCAGAGCTCACGTGCGATTCATTTGGCCTCG
GATGAGCAGAGACAAGCTGAGAGCTCTGCGGATGGGTCGGGGACTGCAACCCCCGCTCGGCAGGAAAGGGAGATT
CAATTTTCTGACGAGATAGACGCAGGACACAATGAC
Transcript >Ophio5|808
ATGGCGGATAACAAGGTTTGGGTAATTCCACTGGAGTTGTCCAACTACAACGTCATCGTGGCCCTGCTGGGCGGC
TTCATCTCGCTCTTTGGCTTGGTTTCCTTTCTGTTGAAGGAGAACTTCTATCTCTCGGAAGCTCTCATCTCTCTC
TTGGCGGGCCTCGCCTTTGGTCCGCTGGGCGCAAACTTCATTCGACCCAGGGCCTATTCCGAGTGCAACCAGAGC
GGTGTGTCGGATATCGAGTGCGAGGATAACCTAAATAGCATCACCCTCAACTTCTCTCGCCTCGTCCTCGCCGTT
CAGCTCGTCCTCGCGGGGGTCCAACTTCCTAGCAAATACCTATGGAAAGAACTGAAGCCTGTCTTGTTACTCATC
GGGCCTGGCATGATATGCATGTGGCTCGCCACCAGTCTTCTCGTCTGGGGCCTCGCGGGCACGCCTAGCTTCCTG
CAAGCCCTGGCCGTCGGGGCGTGTGTCACGCCTACGGATCCTGTCCTATCGGCCGTGATTGTCAAGGGCAAATTT
GCCGACGAGAATATACCCAAGGACCTCCAAAACCTTATCATAGCGGAATCGGGTGTCAACGATGGGCTCGGCTAC
CCGTTCTTGTTCCTCGCCCTCTACCTCATCAAGTATATCGGCTCCGGATCCTCGTCCGGTGGCGTGAGGGAGGCC
ATCGGTCTCTGGTTCGCGATAACCTGGGCGTATACAATACTGCTCAGCATCGTATTCGGCGCTGTGGTGGGATGG
ATAGCCAAGGAGCTGCTTCACTGGGCCGAGGAGCGCAACTACGTCGATCGCGAAAGCTTTCTCATCTTCTCTATT
GCGCTCGCCCTGTTTGTACTAGGGACCTGTGGCCTGATTGGAACCGATGATCTTCTCGCCTGCTTCATCGCCGGT
AATACGTTTACGTGGGACGATTGGTTCCGCGTGCAGACCCAAGACGACTCTCTCCAGCCGACGATCGATATGCTA
CTCAACGTATCCATCTTCCTCTGGTACGGCGCGTCCCTCCCCTGGGGCCTCTTTGGTCACAACGCCGTCATCTCT
ACCGGGCGACTCGTCGCTCTCGGCTTCCTCGTGCTGCTTCTCAGGCGATTGCCGTGGGTCTTTTGTATGCATAGG
TGGATCGGCCAGATCGAAGACGTCACGCAAGCCATTTTCGTCGGTTTCTTCGGACCCATTGGTGTCTCGGCCGTC
TTTTATCTACTAATCTGCCTGAATTTCATCGAGGATCATCTGAGCGACGAGAATGGACAGGCAAGAAACGACGTG
ACGAATTTTGGCGAAACTATTCGTGTCATCGTCTGGTTTCTCGTTGTTTGTAGCACTGTTGTTCATGGACTCAGC
ATTCCGCTCGGCAAGATGGGATACCTGGCACCGAGAAAGATTGGGCGTGTTGTGAGTCGGAGTTTGAGTGATGAG
CCACGCATGGTGCAGGCTCGAGTCAAGATGCCCGTCATAGATGTTCAGAGCTCACGTGCGATTCATTTGGCCTCG
GATGAGCAGAGACAAGCTGAGAGCTCTGCGGATGGGTCGGGGACTGCAACCCCCGCTCGGCAGGAAAGGGAGATT
CAATTTTCTGACGAGATAGACGCAGGACACAATGACTGA
Gene >Ophio5|808
ATGGCGGATAACAAGGTTTGGGTAATTCCACTGGAGTTGTCCAACTACAACGTCATCGTGGCCCTGCTGGGCGGC
TTCATCTCGCTCTTTGGCTTGGTTTCCTTTCTGTTGAAGGAGAACTTCTATCTCTCGGAAGCTCGTAAGTCCCCT
TGCATGGATCCCGATGTAACGTAGCGCCACATGCATTCCTAGTGCTAAGCTTCTCATAGTCATCTCTCTCTTGGC
GGGCCTCGCCTTTGGTCCGCTGGGCGCAAACTTCATTCGACCCAGGGCCTATTCCGAGTGCAACCAGAGCGGTGT
GTCGGATATCGAGTGCGAGGATAACCTAAATAGCATCACCCTCAACTTCTCTCGCCTCGTCCTCGCCGTTCAGCT
CGTCCTCGCGGGGGTCCAACTTCCTAGCAAATACCTATGGAAAGAACTGAAGCCTGTCTTGTTACTCATCGGGCC
TGGCATGATATGCATGTGGCTCGCCACCAGTCTTCTCGTCTGGGGCCTCGCGGGCACGCCTAGCTTCCTGCAAGC
CCTGGCCGTCGGGGCGTGTGTCACGCCTACGGATCCTGTCCTATCGGCCGTGATTGTCAAGGGCAAATTTGCCGA
CGAGAATATACCCAAGGACCTCCAAAACCTTATCATAGCGGAATCGGGTGTCAACGATGGGCTCGGCTACCCGTT
CTTGTTCCTCGCCCTCTACCTCATCAAGTATATCGGCTCCGGATCCTCGTCCGGTGGCGTGAGGGAGGCCATCGG
TCTCTGGTTCGCGATAACCTGGGCGTATACAATACTGCTCAGCATCGTATTCGGCGCTGTGGTGGGATGGATAGC
CAAGGAGCTGCTTCACTGGGCCGAGGAGCGCAACTACGTCGATCGCGAAAGCTTTCTCATCTTCTCTATTGCGCT
CGCCCTGTTTGTACTAGGGACCTGTGGCCTGATTGGAACCGATGATCTTCTCGCCTGCTTCATCGCCGGTAATAC
GTTTACGTGGGACGATTGGTTCCGCGTGCAGACCCAAGACGACTCTCTCCAGCCGACGATCGATATGCTACTCAA
CGTATCCATCTTCCTCTGGTACGGCGCGTCCCTCCCCTGGGGCCTCTTTGGTCACAACGCCGTCATCTCTACCGG
GCGACTCGTCGCTCTCGGCTTCCTCGTGCTGCTTCTCAGGCGATTGCCGTGGGTCTTTTGTATGCATAGGTGGAT
CGGCCAGATCGAAGACGTCACGCAAGCCATTTTCGTCGGTTTCTTCGGACCCATTGGTGTCTCGGCCGTCTTTTA
TCTACTAATCTGCCTGAATTTCATCGAGGATCATCTGAGCGACGAGAATGGACAGGCAAGAAACGACGTGACGAA
TTTTGGCGAAACTATTCGTGTCATCGTCTGGTTTCTCGTTGTTTGTAGCACTGTGAGTGTTTACATGCCGCAACA
TGTCTCCTCGTCCCGCCCTCCTTCCGTCTAACCCTTGGCTCCATCAGGTTGTTCATGGACTCAGCATTCCGCTCG
GCAAGATGGGATACCTGGCACCGAGAAAGATTGGGCGTGTTGTGAGTCGGAGTTTGAGTGATGAGCCACGCATGG
TGCAGGCTCGAGTCAAGATGCCCGTCATAGGCAGGTATTTCTCCGCCAGGAACACGAGTGGCAGCGTCGTGACCA
GCCCCGCCAGGAGGAGCTCTATAGATGTTCAGAGCTCACGTGCGATTCATTTGGCCTCGGATGAGCAGAGACAAG
CTGAGAGCTCTGCGGATGGGTCGGGGACTGCAACCCCCGCTCGGCAGGAAAGGGAGATTCAATTTTCTGACGAGA
TAGACGCAGGACACAATGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail