Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8076
Gene name
Locationscaffold_854:3756..5387
Strand+
Gene length (bp)1631
Transcript length (bp)1512
Coding sequence length (bp)1509
Protein length (aa) 503

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00010 HLH Helix-loop-helix DNA-binding domain 1.0E-11 339 382

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q04635|ESC1_SCHPO Protein esc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=esc1 PE=2 SV=1 326 413 6.0E-17

GO

GO Term Description Terminal node
GO:0046983 protein dimerization activity Yes
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0005515 protein binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.5353 0.7834 0.0812 0.0391 0.1242 0.0002 0.0551 0.0809 0.0292 0.0022

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Helix-loop-helix

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4651
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1428
Ophiocordyceps australis map64 (Brazil) OphauB2|5454
Ophiocordyceps camponoti-floridani Ophcf2|04644
Ophiocordyceps camponoti-rufipedis Ophun1|806
Ophiocordyceps kimflemingae Ophio5|8076 (this protein)
Ophiocordyceps subramaniannii Hirsu2|98

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8076
MEAQQQRPTPAKAAGLTNILNQDDQPSAHNAPLPQLRDSGFYSTTDASSKHTSAASFSVNGLSPTASGYQSSSAD
KTPSPVAANMMPQALVSPSASNMSVASMVSPTSPVSVDQRRFNRPTSLESQGVSNGASLGESLAAGASLPRRESV
DSRINQGFSDMRLGGSPYTSNNQSTSSIQNTLHSQRNPRPGFEALSMHRISNGYQPSADRNPEPKTVKTAPAITG
PATGHIARAAEPTKGQAWAFPEEEISRVGPRYDDSRRSSITESVASSQFTAESRLPPGQRRLDDGADHARLTHPT
DFPPVHHHTMQHKQLSDLQAEEGGGPTGSQPYSRTPELRVSHKLAERKRRTEMKELFDQLRDLMPQERGSKASKW
EILTKAIAEHQRMNEHIRLLQTHYNTALAENDMLRREMHGMRVEGAHASGHGQQNAQQQPPQPPPPQAQQAQPSS
QPGQYSADHYSSANRTELPPLRSISSSIPSGPDSMTGVQYEPPRVNGYRQERY
Coding >Ophio5|8076
ATGGAGGCCCAGCAGCAGCGGCCGACGCCTGCCAAGGCTGCGGGCTTGACAAACATACTCAATCAAGACGACCAA
CCATCGGCGCACAATGCCCCTCTCCCCCAGCTGCGCGATTCTGGCTTCTACTCGACGACAGATGCGTCGAGCAAA
CACACGTCTGCCGCTTCGTTCAGCGTCAACGGGCTCAGCCCGACCGCCTCGGGCTATCAGTCGTCGTCGGCGGAC
AAGACGCCTTCGCCCGTCGCCGCCAACATGATGCCACAGGCGCTCGTCTCGCCTTCGGCCAGCAACATGAGCGTA
GCCTCCATGGTCTCGCCCACGAGCCCCGTCAGCGTCGATCAGCGCCGATTCAACCGTCCCACCTCGCTCGAATCG
CAGGGCGTCTCCAATGGCGCCTCCCTGGGTGAGAGCCTCGCAGCCGGCGCCTCGCTCCCTAGGCGCGAGAGCGTC
GACAGCAGGATCAACCAGGGCTTCAGCGACATGCGCCTCGGCGGCTCCCCCTACACGAGCAACAACCAATCGACG
AGCTCGATCCAGAACACGCTTCACTCGCAGCGGAACCCCCGACCCGGGTTCGAGGCCTTGTCGATGCACAGAATC
TCCAACGGATACCAGCCCAGCGCGGATCGAAACCCGGAACCGAAGACGGTCAAGACGGCGCCGGCCATCACCGGC
CCTGCCACTGGCCACATCGCTCGGGCCGCGGAGCCGACTAAGGGTCAGGCCTGGGCCTTTCCCGAGGAGGAGATA
TCGAGAGTGGGGCCTCGCTACGACGACTCGCGGCGGAGCAGCATCACCGAGTCCGTGGCCAGCAGCCAGTTCACG
GCCGAGTCCCGGCTGCCGCCCGGCCAGCGGAGACTGGACGACGGCGCGGATCACGCCCGGCTGACCCACCCCACC
GACTTCCCGCCCGTCCACCACCACACCATGCAGCACAAGCAGCTCAGCGACCTGCAGGCCGAGGAGGGCGGCGGG
CCCACCGGCTCCCAGCCTTACAGCCGGACGCCCGAACTGAGGGTGAGCCATAAACTGGCCGAGAGAAAGCGACGG
ACCGAGATGAAGGAGCTTTTCGACCAGCTGCGAGACTTGATGCCGCAGGAGCGCGGGTCCAAGGCCTCCAAGTGG
GAAATCTTGACCAAAGCTATTGCGGAGCATCAAAGAATGAACGAGCACATTCGGCTGCTGCAGACGCACTACAAC
ACGGCGCTGGCCGAGAACGACATGCTTCGGCGCGAGATGCACGGCATGAGGGTGGAGGGCGCACATGCCTCCGGA
CACGGCCAGCAAAACGCGCAGCAACAGCCGCCGCAGCCGCCGCCGCCGCAAGCGCAACAGGCGCAGCCGAGCTCA
CAGCCGGGTCAGTACTCGGCGGACCACTACTCGAGCGCCAACCGGACAGAGCTGCCGCCGCTGCGATCCATCAGC
AGCAGCATACCCAGCGGTCCGGACTCGATGACTGGCGTCCAATACGAGCCGCCGCGGGTCAACGGATACCGGCAA
GAGAGATAC
Transcript >Ophio5|8076
ATGGAGGCCCAGCAGCAGCGGCCGACGCCTGCCAAGGCTGCGGGCTTGACAAACATACTCAATCAAGACGACCAA
CCATCGGCGCACAATGCCCCTCTCCCCCAGCTGCGCGATTCTGGCTTCTACTCGACGACAGATGCGTCGAGCAAA
CACACGTCTGCCGCTTCGTTCAGCGTCAACGGGCTCAGCCCGACCGCCTCGGGCTATCAGTCGTCGTCGGCGGAC
AAGACGCCTTCGCCCGTCGCCGCCAACATGATGCCACAGGCGCTCGTCTCGCCTTCGGCCAGCAACATGAGCGTA
GCCTCCATGGTCTCGCCCACGAGCCCCGTCAGCGTCGATCAGCGCCGATTCAACCGTCCCACCTCGCTCGAATCG
CAGGGCGTCTCCAATGGCGCCTCCCTGGGTGAGAGCCTCGCAGCCGGCGCCTCGCTCCCTAGGCGCGAGAGCGTC
GACAGCAGGATCAACCAGGGCTTCAGCGACATGCGCCTCGGCGGCTCCCCCTACACGAGCAACAACCAATCGACG
AGCTCGATCCAGAACACGCTTCACTCGCAGCGGAACCCCCGACCCGGGTTCGAGGCCTTGTCGATGCACAGAATC
TCCAACGGATACCAGCCCAGCGCGGATCGAAACCCGGAACCGAAGACGGTCAAGACGGCGCCGGCCATCACCGGC
CCTGCCACTGGCCACATCGCTCGGGCCGCGGAGCCGACTAAGGGTCAGGCCTGGGCCTTTCCCGAGGAGGAGATA
TCGAGAGTGGGGCCTCGCTACGACGACTCGCGGCGGAGCAGCATCACCGAGTCCGTGGCCAGCAGCCAGTTCACG
GCCGAGTCCCGGCTGCCGCCCGGCCAGCGGAGACTGGACGACGGCGCGGATCACGCCCGGCTGACCCACCCCACC
GACTTCCCGCCCGTCCACCACCACACCATGCAGCACAAGCAGCTCAGCGACCTGCAGGCCGAGGAGGGCGGCGGG
CCCACCGGCTCCCAGCCTTACAGCCGGACGCCCGAACTGAGGGTGAGCCATAAACTGGCCGAGAGAAAGCGACGG
ACCGAGATGAAGGAGCTTTTCGACCAGCTGCGAGACTTGATGCCGCAGGAGCGCGGGTCCAAGGCCTCCAAGTGG
GAAATCTTGACCAAAGCTATTGCGGAGCATCAAAGAATGAACGAGCACATTCGGCTGCTGCAGACGCACTACAAC
ACGGCGCTGGCCGAGAACGACATGCTTCGGCGCGAGATGCACGGCATGAGGGTGGAGGGCGCACATGCCTCCGGA
CACGGCCAGCAAAACGCGCAGCAACAGCCGCCGCAGCCGCCGCCGCCGCAAGCGCAACAGGCGCAGCCGAGCTCA
CAGCCGGGTCAGTACTCGGCGGACCACTACTCGAGCGCCAACCGGACAGAGCTGCCGCCGCTGCGATCCATCAGC
AGCAGCATACCCAGCGGTCCGGACTCGATGACTGGCGTCCAATACGAGCCGCCGCGGGTCAACGGATACCGGCAA
GAGAGATACTGA
Gene >Ophio5|8076
ATGGAGGCCCAGCAGCAGCGGCCGACGCCTGCCAAGGCTGCGGGCTTGACAAACATACTCAATCAAGACGACCAA
CCATCGGCGCACAATGCCCCTCTCCCCCAGCTGCGCGATTCTGGCTTCTACTCGACGACAGATGCGTCGAGCAAA
CGTAGGTGGCGGTCTGCCTCCGATCCCCCCCCCCCCCTTACCGTCGCTCACCCTCGGCCCTGCAGACACGTCTGC
CGCTTCGTTCAGCGTCAACGGGCTCAGCCCGACCGCCTCGGGCTATCAGTCGTCGTCGGCGGACAAGACGCCTTC
GCCCGTCGCCGCCAACATGATGCCACAGGCGCTCGTCTCGCCTTCGGCCAGCAACATGAGCGTAGCCTCCATGGT
CTCGCCCACGAGCCCCGTCAGCGTCGATCAGCGCCGATTCAACCGTCCCACCTCGCTCGAATCGCAGGGCGTCTC
CAATGGCGCCTCCCTGGGTGAGAGCCTCGCAGCCGGCGCCTCGCTCCCTAGGCGCGAGAGCGTCGACAGCAGGAT
CAACCAGGGCTTCAGCGACATGCGCCTCGGCGGCTCCCCCTACACGAGCAACAACCAATCGACGAGCTCGATCCA
GAACACGCTTCACTCGCAGCGGAACCCCCGACCCGGGTTCGAGGCCTTGTCGATGCACAGAATCTCCAACGGATA
CCAGCCCAGCGCGGATCGAAACCCGGAACCGAAGACGGTCAAGACGGCGCCGGCCATCACCGGCCCTGCCACTGG
CCACATCGCTCGGGCCGCGGAGCCGACTAAGGGTCAGGCCTGGGCCTTTCCCGAGGAGGAGATATCGAGAGTGGG
GCCTCGCTACGACGACTCGCGGCGGAGCAGCATCACCGAGTCCGTGGCCAGCAGCCAGTTCACGGCCGAGTCCCG
GCTGCCGCCCGGCCAGCGGAGACTGGACGACGGCGCGGATCACGCCCGGCTGACCCACCCCACCGACTTCCCGCC
CGTCCACCACCACACCATGCAGCACAAGCAGCTCAGCGACCTGCAGGCCGAGGAGGGCGGCGGGCCCACCGGCTC
CCAGCCTTACAGCCGGACGCCCGAACTGAGGGTGAGCCATAAACTGGCCGAGAGAAAGCGACGGACCGAGATGAA
GGAGCTTTTCGACCAGCTGCGAGACTTGATGCCGCAGGAGCGCGGGTCCAAGGCCTCCAAGTGGGAAATCTTGAC
CAAAGGTTCGATGATGAAGGACGTGTTTACCATCTATCAAACTGATTTTTGCTATACCAGCTATTGCGGAGCATC
AAAGAATGAACGAGCACATTCGGCTGCTGCAGACGCACTACAACACGGCGCTGGCCGAGAACGACATGCTTCGGC
GCGAGATGCACGGCATGAGGGTGGAGGGCGCACATGCCTCCGGACACGGCCAGCAAAACGCGCAGCAACAGCCGC
CGCAGCCGCCGCCGCCGCAAGCGCAACAGGCGCAGCCGAGCTCACAGCCGGGTCAGTACTCGGCGGACCACTACT
CGAGCGCCAACCGGACAGAGCTGCCGCCGCTGCGATCCATCAGCAGCAGCATACCCAGCGGTCCGGACTCGATGA
CTGGCGTCCAATACGAGCCGCCGCGGGTCAACGGATACCGGCAAGAGAGATACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail