Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8075
Gene name
Locationscaffold_853:3548..5929
Strand+
Gene length (bp)2381
Transcript length (bp)1935
Coding sequence length (bp)1932
Protein length (aa) 644

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00149 Metallophos Calcineurin-like phosphoesterase 5.6E-13 60 291

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4B093|A1864_ARTBC Secreted protein ARB_01864 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01864 PE=1 SV=1 22 642 0.0E+00
sp|Q9HDU9|YHE6_SCHPO Uncharacterized protein PB2B2.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPB2B2.06c PE=3 SV=1 52 606 5.0E-138
sp|Q9US39|YFZ2_SCHPO Uncharacterized protein C1039.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.02 PE=3 SV=1 52 606 4.0E-133
sp|O13781|YEO3_SCHPO Uncharacterized protein C17G6.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17G6.03 PE=3 SV=1 51 607 2.0E-94
sp|P38887|YH02_YEAST Uncharacterized protein YHR202W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHR202W PE=1 SV=1 50 630 8.0E-91

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 54.38 29.56 79.20
CcL In ants, during behavior modification 95.42 49.59 141.25
CcD In ants, recently dead 57.78 31.39 84.17

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.011792 yes
SC16a CcD 0.831043 no
CcL CcD 0.029476 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8075
MLASLGLGVFLLPTAIACGVGSCYGPLNRVEHVRHVKRMQPGASDAIYGPKRPLEWGQVNFLHTTDTHGWLEGHI
KERNYGADWGDFVSFARRMKQTACHLGVDLLLVDTGDLHDGTGLSDATAVDGAESMPIFDQIDYDLLTIGNHELY
VSEVAYQMLDQYARRWGDKYVTSNVQVLNRTSGQYQYVGATHRYFTTAQGLRILAFGVLFDFAGSKGNSNASRVL
KAVDMVEEDWFKNVLANTGAVDLFVVLGHNPARPSNRQSTFRVVLDAIRAVHPTTPIQIFGGHSHIRDFVVYDDS
SVALESGRYCETLGWTSMAGFNSSSGRYAKVAKSLGVGSASRPARPGSGSPFVYSRRYLDWNRKTFVYHSKREDK
TFDHDSGRRLTGHITKVRDELRLGDVYGCAPQDWCAYCVPFDDVTKNVFPGVIYPAVAYAVVNTSRADRPRIILG
NTGGIRFDVHKGPFTHDDSLIVSPFRNAFLSISDVPYAEASQLLQQLNRGLADKRHVAPLVAGLGDHCTDPTLGY
MDEMRGSRGIFRRQESVTPGYVTTDDWGDDGDDTEHSKIPSFTIPNYWEARASFPVNGSEPDRVDVVFVDFIEKR
VLDNLGEGYRNQVHCYIDCNFTSQDVLRRYTQWAWQANRDNCPS
Coding >Ophio5|8075
ATGCTCGCGAGTCTCGGTCTCGGCGTCTTCCTCCTCCCGACGGCAATCGCCTGCGGCGTCGGCAGCTGCTACGGC
CCATTGAACCGCGTCGAGCACGTTCGCCACGTGAAGCGCATGCAGCCGGGCGCGTCCGACGCCATCTACGGCCCG
AAGCGTCCCCTGGAATGGGGCCAGGTTAACTTCCTCCACACGACGGACACGCACGGCTGGCTCGAGGGCCACATC
AAGGAGCGCAACTATGGCGCCGACTGGGGCGACTTTGTCTCCTTTGCTCGTCGTATGAAGCAGACGGCCTGTCAC
TTGGGCGTCGACCTGCTGCTCGTCGACACGGGTGATCTCCACGATGGAACCGGCCTTTCGGATGCCACGGCCGTT
GATGGCGCCGAGTCGATGCCCATCTTTGATCAGATCGACTATGACCTTCTCACAATTGGCAATCATGAGCTGTAC
GTGTCCGAAGTCGCCTACCAGATGCTGGACCAGTACGCCCGCAGATGGGGAGACAAGTATGTCACGTCCAACGTT
CAGGTGCTCAACCGGACGTCGGGCCAGTATCAGTATGTGGGCGCCACTCATCGATACTTTACCACGGCTCAGGGG
CTACGCATCCTGGCCTTTGGCGTCCTCTTTGATTTTGCAGGCTCAAAAGGCAACTCGAATGCTTCCCGCGTCCTC
AAAGCCGTAGATATGGTCGAGGAGGACTGGTTCAAGAACGTCTTGGCCAATACAGGCGCCGTCGATCTGTTTGTC
GTCTTAGGGCACAACCCGGCGCGACCGTCTAATCGCCAAAGCACCTTCAGAGTCGTCTTGGACGCCATTCGTGCC
GTACATCCCACAACGCCCATCCAAATCTTTGGTGGCCACAGCCACATCCGAGATTTCGTCGTCTACGATGATTCG
TCGGTCGCGCTCGAGTCCGGCCGGTACTGCGAGACGCTCGGCTGGACATCCATGGCCGGCTTCAACTCGTCCAGC
GGCCGTTACGCCAAGGTCGCCAAGTCCCTGGGCGTGGGGAGTGCGTCTCGCCCGGCCAGACCCGGCTCCGGGTCG
CCGTTTGTGTACTCGCGCCGCTACCTTGACTGGAATCGCAAGACGTTCGTCTATCATTCGAAAAGAGAGGACAAG
ACATTCGACCATGATTCGGGCCGGCGCCTGACGGGCCACATCACAAAGGTGCGCGATGAGCTGCGGCTGGGCGAC
GTCTATGGATGTGCGCCGCAGGACTGGTGCGCCTACTGCGTTCCTTTCGACGACGTCACCAAAAACGTGTTCCCC
GGCGTCATTTATCCTGCCGTGGCCTATGCCGTCGTCAACACGAGTCGAGCCGACAGACCGCGCATCATCCTCGGC
AACACTGGGGGCATCCGCTTCGACGTTCATAAGGGCCCCTTTACCCACGACGACAGCCTGATTGTGTCTCCCTTC
CGCAACGCGTTTCTGTCCATATCCGACGTGCCCTATGCCGAGGCCTCTCAGCTGCTGCAACAGCTCAATCGCGGC
TTGGCGGACAAGCGACATGTCGCCCCCCTCGTGGCCGGCCTCGGCGACCATTGTACCGATCCGACGCTCGGCTAC
ATGGACGAGATGCGTGGCAGCCGAGGCATTTTTCGTCGCCAGGAATCGGTTACTCCCGGCTACGTGACAACGGAC
GACTGGGGTGACGACGGGGACGACACGGAGCACTCCAAGATTCCGAGCTTCACGATACCCAACTACTGGGAGGCG
CGCGCATCGTTTCCCGTCAACGGCAGCGAGCCAGATCGGGTGGACGTGGTCTTTGTCGACTTCATCGAGAAGCGC
GTGCTCGACAATCTGGGCGAGGGCTACCGGAACCAGGTGCATTGCTACATTGACTGCAACTTTACCTCACAGGAT
GTTCTACGTCGATATACCCAGTGGGCGTGGCAGGCCAACCGTGACAACTGTCCGAGC
Transcript >Ophio5|8075
ATGCTCGCGAGTCTCGGTCTCGGCGTCTTCCTCCTCCCGACGGCAATCGCCTGCGGCGTCGGCAGCTGCTACGGC
CCATTGAACCGCGTCGAGCACGTTCGCCACGTGAAGCGCATGCAGCCGGGCGCGTCCGACGCCATCTACGGCCCG
AAGCGTCCCCTGGAATGGGGCCAGGTTAACTTCCTCCACACGACGGACACGCACGGCTGGCTCGAGGGCCACATC
AAGGAGCGCAACTATGGCGCCGACTGGGGCGACTTTGTCTCCTTTGCTCGTCGTATGAAGCAGACGGCCTGTCAC
TTGGGCGTCGACCTGCTGCTCGTCGACACGGGTGATCTCCACGATGGAACCGGCCTTTCGGATGCCACGGCCGTT
GATGGCGCCGAGTCGATGCCCATCTTTGATCAGATCGACTATGACCTTCTCACAATTGGCAATCATGAGCTGTAC
GTGTCCGAAGTCGCCTACCAGATGCTGGACCAGTACGCCCGCAGATGGGGAGACAAGTATGTCACGTCCAACGTT
CAGGTGCTCAACCGGACGTCGGGCCAGTATCAGTATGTGGGCGCCACTCATCGATACTTTACCACGGCTCAGGGG
CTACGCATCCTGGCCTTTGGCGTCCTCTTTGATTTTGCAGGCTCAAAAGGCAACTCGAATGCTTCCCGCGTCCTC
AAAGCCGTAGATATGGTCGAGGAGGACTGGTTCAAGAACGTCTTGGCCAATACAGGCGCCGTCGATCTGTTTGTC
GTCTTAGGGCACAACCCGGCGCGACCGTCTAATCGCCAAAGCACCTTCAGAGTCGTCTTGGACGCCATTCGTGCC
GTACATCCCACAACGCCCATCCAAATCTTTGGTGGCCACAGCCACATCCGAGATTTCGTCGTCTACGATGATTCG
TCGGTCGCGCTCGAGTCCGGCCGGTACTGCGAGACGCTCGGCTGGACATCCATGGCCGGCTTCAACTCGTCCAGC
GGCCGTTACGCCAAGGTCGCCAAGTCCCTGGGCGTGGGGAGTGCGTCTCGCCCGGCCAGACCCGGCTCCGGGTCG
CCGTTTGTGTACTCGCGCCGCTACCTTGACTGGAATCGCAAGACGTTCGTCTATCATTCGAAAAGAGAGGACAAG
ACATTCGACCATGATTCGGGCCGGCGCCTGACGGGCCACATCACAAAGGTGCGCGATGAGCTGCGGCTGGGCGAC
GTCTATGGATGTGCGCCGCAGGACTGGTGCGCCTACTGCGTTCCTTTCGACGACGTCACCAAAAACGTGTTCCCC
GGCGTCATTTATCCTGCCGTGGCCTATGCCGTCGTCAACACGAGTCGAGCCGACAGACCGCGCATCATCCTCGGC
AACACTGGGGGCATCCGCTTCGACGTTCATAAGGGCCCCTTTACCCACGACGACAGCCTGATTGTGTCTCCCTTC
CGCAACGCGTTTCTGTCCATATCCGACGTGCCCTATGCCGAGGCCTCTCAGCTGCTGCAACAGCTCAATCGCGGC
TTGGCGGACAAGCGACATGTCGCCCCCCTCGTGGCCGGCCTCGGCGACCATTGTACCGATCCGACGCTCGGCTAC
ATGGACGAGATGCGTGGCAGCCGAGGCATTTTTCGTCGCCAGGAATCGGTTACTCCCGGCTACGTGACAACGGAC
GACTGGGGTGACGACGGGGACGACACGGAGCACTCCAAGATTCCGAGCTTCACGATACCCAACTACTGGGAGGCG
CGCGCATCGTTTCCCGTCAACGGCAGCGAGCCAGATCGGGTGGACGTGGTCTTTGTCGACTTCATCGAGAAGCGC
GTGCTCGACAATCTGGGCGAGGGCTACCGGAACCAGGTGCATTGCTACATTGACTGCAACTTTACCTCACAGGAT
GTTCTACGTCGATATACCCAGTGGGCGTGGCAGGCCAACCGTGACAACTGTCCGAGCTAA
Gene >Ophio5|8075
ATGCTCGCGAGTCTCGGTCTCGGCGTCTTCCTCCTCCCGACGGCAATCGCCTGCGGCGTCGGCAGCTGCTACGGC
CCATTGAACCGCGTCGAGCACGTTCGCCACGTGAAGCGCATGCAGCCGGGCGCGTCCGACGCCATCTACGGCCCG
AAGCGTCCCCTGGAATGGGGCCAGGTTAACTTCCTCCACACGGTAAGCCCGCGAGCTTCTCCCCTTCCCTCCCTC
AGACTCGAGCTGACGGCTCGCCTGCTAGACGGACACGCACGGCTGGCTCGAGGGCCACATCAAGGAGCGCAACTA
TGGCGCCGACTGGGGCGACTTTGTCTCCTTTGCTCGTCGTATGAAGCAGACGGCCTGTCACTTGGGCGTCGACCT
GCTGCTCGTCGACACGGGTGATCTCCACGATGGAACCGGCCTTTCGGATGCCACGGCCGTTGATGGCGCCGAGTC
GATGCCCATCTTTGATCAGATCGACTATGACCTTCTCACAATTGGTGCGTCTGGCTGCTGTCCGGGCTACCTGCT
GTCTGACGGCCTCGGACGCAGGCAATCATGAGCTGTACGTGTCCGAAGTCGCCTACCAGATGCTGGACCAGTACG
CCCGCAGATGGGGAGACAAGTATGTCACGTCCAACGTTCAGGTGCTCAACCGGACGTCGGGCCAGTATCAGTATG
TGGGCGCCACTCATCGATACTTTACCACGGCTCAGGGGCTACGCATCCTGGCCTTTGGCGTCCTCTTTGATTTTG
CAGGTAGGCTTTGCGTGAATGACGGATGCTTTCTTTGACCCTCCAGATGATCTACCAATGTGTATCCCTCTATAA
AGTACTGCTACTCGCGGCTAACGTCAGGCTCAAAAGGCAACTCGAATGCTTCCCGCGTCCTCAAAGCCGTAGATA
TGGTCGAGGAGGACTGGTTCAAGAACGTCTTGGCCAATACAGGCGCCGTCGATCTGTTTGTCGTCTTAGGGCACA
ACCCGGCGCGACCGTCTAATCGCCAAAGCACCTTCAGAGTCGTCTTGGACGCCATTCGTGCCGTACATCCCACAA
CGCCCATCCAAATCTTTGGTGGCCACAGCCACATCCGAGATTTCGTCGTCTACGATGATTCGTCGGTCGCGCTCG
AGTCCGGCCGGTACTGCGAGACGCTCGGCTGGACATCCATGGCCGGCTTCAACTCGTCCAGCGGCCGTTACGCCA
AGGTCGCCAAGTCCCTGGGCGTGGGGAGTGCGTCTCGCCCGGCCAGACCCGGCTCCGGGTCGCCGTTTGTGTACT
CGCGCCGCTACCTTGACTGGAATCGCAAGACGTTCGTCTATCATTCGAAAAGAGAGGACAAGACATTCGACCATG
ATTCGGGCCGGCGCCTGACGGGCCACATCACAAAGGTGCGCGATGAGCTGCGGCTGGGCGACGTCTATGGATGTG
CGCCGCAGGACTGGTGCGCCTACTGCGTTCCTTTCGACGACGTCACCAAAAACGTGTTCCCCGGCGTCATTTATC
CTGCCGTGGCCTATGCCGTCGTCAACACGAGTCGAGCCGACAGACCGCGCATCATCCTCGGCAACACTGGGGGCA
TCCGCTTCGACGTTCATAAGGGCCCCTTTACCCACGACGACAGCCTGATTGTGTCTCCCTTCCGCAACGCGTTTC
TGTCCATATCCGACGTGCCCTATGCCGAGGCCTCTCAGCTGCTGCAACAGTGAGAATGGCGTCGGGGCTCTGTAC
CGTCCGGTCGGTGACTGACATGTTGACTGCCAGGCTCAATCGCGGCTTGGCGGACAAGCGACATGTCGCCCCCCT
CGTGGCCGGCCTCGGCGACCATTGTACCGATCCGACGCTCGGCTACATGGACGAGATGCGTGGCAGCCGAGGCAT
TTTTCGTCGCCAGGAATCGGTTACTCCCGGCTACGTGACAACGGACGACTGGGGTGACGACGGCATGTTTTCCCA
AGGGCGACATGTCGACGGTGGCGCGACTGACGGCGACGCAGGGGACGACACGGAGCACTCCAAGATTCCGAGCTT
CACGATACCCAACTACTGGGAGGCGCGCGCATCGTTTCCCGTCAACGGCAGCGAGCCAGATCGGGTGGACGTGGT
CTTTGTCGACTTGTACGTGGTGGTGTGCAACGGGGGTGTCCCGACGGCGGTAGACGCTGACCATCTGTGACGTAG
CATCGAGAAGCGCGTGCTCGACAATCTGGGCGAGGGCTACCGGAACCAGGTGCATTGCTACATTGACTGCAACTT
TACCTCACAGGGTGAGTGAGGGACACACTCACTTGTGCTGTGCTTCAGGGGCGCGGCTGACGCGTGCAGATGTTC
TACGTCGATATACCCAGTGGGCGTGGCAGGCCAACCGTGACAACTGTCCGAGCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail