Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8071
Gene name
Locationscaffold_852:4191..6478
Strand-
Gene length (bp)2287
Transcript length (bp)2187
Coding sequence length (bp)2184
Protein length (aa) 728

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04082 Fungal_trans Fungal specific transcription factor domain 1.6E-13 220 405

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P40467|ASG1_YEAST Activator of stress genes 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASG1 PE=1 SV=1 196 584 5.0E-12
sp|Q9UTN0|YII3_SCHPO Uncharacterized transcriptional regulatory protein C139.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC139.03 PE=3 SV=1 180 404 7.0E-10

GO

GO Term Description Terminal node
GO:0006351 transcription, DNA-templated Yes
GO:0008270 zinc ion binding Yes
GO:0003677 DNA binding Yes
GO:0046872 metal ion binding No
GO:0003674 molecular_function No
GO:0044237 cellular metabolic process No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0008152 metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0003676 nucleic acid binding No
GO:0090304 nucleic acid metabolic process No
GO:0044238 primary metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008150 biological_process No
GO:0019438 aromatic compound biosynthetic process No
GO:0016070 RNA metabolic process No
GO:0009058 biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0046914 transition metal ion binding No
GO:0097159 organic cyclic compound binding No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0097659 nucleic acid-templated transcription No
GO:0009059 macromolecule biosynthetic process No
GO:1901363 heterocyclic compound binding No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0032774 RNA biosynthetic process No
GO:0009987 cellular process No
GO:0043170 macromolecule metabolic process No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal|Nuclear export signal 0.3681 0.8845 0.0345 0.2239 0.0438 0.0134 0.0271 0.3497 0.128 0.006

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Fungal Specific TF

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3536
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|651
Ophiocordyceps australis map64 (Brazil) OphauB2|1182
Ophiocordyceps camponoti-floridani Ophcf2|06752
Ophiocordyceps camponoti-rufipedis Ophun1|896
Ophiocordyceps kimflemingae Ophio5|8071 (this protein)
Ophiocordyceps subramaniannii Hirsu2|6783

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8071
MPAASSGPGPSSPAPNAASASYDVIACCLAPNSGNLSDASDAETVEPSRPFKRNCPSISSGAAINATSDIAHAAT
RSGDSPKPPFLEELWLRMDRLEKYVRARSPGTDVSGGRAIAAPPNTTRAVSVKAGAQQTRFFGQNSTRVLMNLFD
DAKAFLDPQQGPLTNSDLLHDLGTLHRSLQDTLRDALTPITVFVDSMMPVQKRMTDILPSKAVCDRMVASYFEVA
ETIFRIVHKPTFFDEYDLYWEGKLQSESFLPQLLAMVSIASRFETKSKGLGRERGEGVHIPTACALVRTWLDGLK
GKQLVRLDTLRVEVLLLHARRMMTPRAEDLWTQLGSVVRMAMTMGMHRDPLECEPRMTVFVGELRRRLWFTIVDT
DVLMSLACSLPSLIRDGDFSCRPPRNLNDSDLFPAMEELPPSKPMDQTTDNQMQVYSAVTLATRMRVPPIVNRLD
ALRDYQEVVEVGAKLERLIDDINFVLPRHSLSNDSQKSREWRSRVVLDMHVRRPLLALYRPLAMGVPDVPPQIMR
AYLRSSMVILKYLDELDPHLAHFQDIVEMYHQVLKREIIQAAMSVCFYIQSAVRPNSEGFVVGRQALRMSPNGSD
GYPSDRAEELVLWSPGRLINTVQNTVNLLVAHMSGSDTKDVVLLTLVLETVKSAEPKAQEVVRELHRLLEACLKA
TGLTREKLHGCYAADGGYGHGRPSYGFGGHRASVSGNSAGKEDGAWILWDGWD
Coding >Ophio5|8071
ATGCCCGCAGCGTCAAGCGGCCCAGGCCCGTCAAGTCCTGCACCGAATGCCGCAAGCGCAAGCTACGATGTGATC
GCCTGCTGCCTTGCTCCCAACTCGGGCAACCTCTCGGATGCCTCCGACGCTGAGACGGTCGAGCCCAGCCGTCCT
TTCAAGCGCAACTGCCCCTCCATCTCGTCTGGCGCTGCCATCAACGCCACCAGCGACATCGCTCACGCCGCCACC
AGGAGCGGCGACTCCCCGAAACCGCCTTTTCTCGAAGAATTGTGGCTGCGCATGGATCGTCTGGAGAAATACGTC
CGCGCCCGCAGCCCAGGCACCGACGTCAGCGGCGGGAGGGCCATTGCCGCGCCGCCCAACACCACCAGGGCCGTG
TCCGTCAAGGCTGGCGCTCAGCAGACACGCTTCTTTGGCCAGAACAGCACCCGCGTCTTGATGAACCTGTTCGAC
GACGCCAAGGCCTTCCTTGACCCCCAGCAAGGCCCCTTGACCAACTCGGATCTTCTGCACGATCTTGGCACCTTG
CACAGGAGTCTGCAGGATACCTTGCGCGATGCCTTGACGCCCATCACCGTCTTCGTCGACTCCATGATGCCCGTC
CAGAAGCGGATGACGGACATCTTGCCCAGCAAGGCCGTCTGCGACCGAATGGTGGCCTCGTACTTTGAGGTGGCC
GAGACCATCTTTCGCATCGTCCACAAGCCTACCTTCTTCGACGAATACGATCTCTACTGGGAGGGCAAGCTTCAG
TCAGAATCCTTCCTCCCCCAGCTGCTGGCCATGGTCTCCATTGCCTCGCGCTTCGAGACCAAGTCCAAGGGTTTG
GGCCGCGAGCGCGGCGAGGGCGTCCACATACCGACGGCCTGCGCCCTCGTCCGCACCTGGCTCGACGGCCTCAAG
GGGAAGCAGCTCGTCAGGCTGGACACGCTGCGGGTCGAGGTGCTGCTGCTGCATGCGCGGCGCATGATGACGCCC
CGCGCCGAGGATCTATGGACCCAGCTCGGCTCCGTCGTTCGCATGGCCATGACCATGGGCATGCACCGGGACCCG
CTCGAGTGCGAGCCCCGCATGACCGTCTTTGTCGGCGAGCTCCGGAGGAGACTGTGGTTCACCATCGTCGACACC
GACGTGCTCATGTCGCTTGCTTGCAGCCTGCCCTCCCTGATCCGCGACGGTGACTTTTCCTGCCGCCCGCCGCGC
AATCTCAACGACTCGGACCTGTTCCCCGCCATGGAGGAGCTGCCTCCGTCGAAGCCGATGGACCAGACGACGGAC
AACCAGATGCAGGTCTACTCGGCCGTGACGCTGGCGACGCGCATGCGCGTGCCGCCCATCGTCAACCGCCTCGAC
GCCCTGCGCGACTACCAGGAGGTGGTCGAGGTAGGCGCCAAGCTGGAGCGGCTCATCGACGACATCAACTTCGTC
TTACCCCGCCACAGCCTTTCCAACGACTCGCAGAAGAGCAGGGAGTGGAGGAGCCGCGTCGTTCTCGACATGCAC
GTCCGGCGGCCGCTGCTTGCCCTGTACCGGCCGCTCGCCATGGGCGTGCCGGACGTGCCGCCGCAGATTATGCGG
GCCTACCTGAGGTCGTCGATGGTGATTCTCAAGTACCTCGACGAGCTCGACCCCCATCTGGCGCACTTCCAGGAC
ATCGTCGAGATGTATCACCAGGTTCTGAAGCGGGAAATCATTCAGGCGGCCATGAGCGTCTGCTTTTACATCCAG
TCGGCGGTGCGGCCCAACTCGGAGGGCTTCGTCGTGGGCCGGCAGGCACTACGCATGTCGCCCAACGGCTCGGAC
GGCTACCCGTCAGACAGGGCCGAGGAGCTGGTGCTGTGGTCTCCGGGCCGCCTCATCAACACGGTGCAGAATACG
GTGAACCTGCTGGTGGCGCACATGAGCGGAAGCGACACCAAGGATGTCGTCCTGCTCACTCTCGTTCTGGAGACG
GTCAAGTCGGCGGAGCCCAAGGCGCAGGAAGTGGTCCGCGAGCTACACAGGCTACTGGAAGCCTGCCTCAAGGCG
ACGGGCCTGACGAGGGAGAAGCTGCACGGATGCTACGCAGCGGACGGCGGCTACGGTCACGGCCGGCCGTCGTAC
GGATTCGGCGGTCACCGGGCGTCTGTCAGCGGTAACAGCGCGGGCAAGGAAGACGGGGCGTGGATTCTGTGGGAT
GGATGGGAT
Transcript >Ophio5|8071
ATGCCCGCAGCGTCAAGCGGCCCAGGCCCGTCAAGTCCTGCACCGAATGCCGCAAGCGCAAGCTACGATGTGATC
GCCTGCTGCCTTGCTCCCAACTCGGGCAACCTCTCGGATGCCTCCGACGCTGAGACGGTCGAGCCCAGCCGTCCT
TTCAAGCGCAACTGCCCCTCCATCTCGTCTGGCGCTGCCATCAACGCCACCAGCGACATCGCTCACGCCGCCACC
AGGAGCGGCGACTCCCCGAAACCGCCTTTTCTCGAAGAATTGTGGCTGCGCATGGATCGTCTGGAGAAATACGTC
CGCGCCCGCAGCCCAGGCACCGACGTCAGCGGCGGGAGGGCCATTGCCGCGCCGCCCAACACCACCAGGGCCGTG
TCCGTCAAGGCTGGCGCTCAGCAGACACGCTTCTTTGGCCAGAACAGCACCCGCGTCTTGATGAACCTGTTCGAC
GACGCCAAGGCCTTCCTTGACCCCCAGCAAGGCCCCTTGACCAACTCGGATCTTCTGCACGATCTTGGCACCTTG
CACAGGAGTCTGCAGGATACCTTGCGCGATGCCTTGACGCCCATCACCGTCTTCGTCGACTCCATGATGCCCGTC
CAGAAGCGGATGACGGACATCTTGCCCAGCAAGGCCGTCTGCGACCGAATGGTGGCCTCGTACTTTGAGGTGGCC
GAGACCATCTTTCGCATCGTCCACAAGCCTACCTTCTTCGACGAATACGATCTCTACTGGGAGGGCAAGCTTCAG
TCAGAATCCTTCCTCCCCCAGCTGCTGGCCATGGTCTCCATTGCCTCGCGCTTCGAGACCAAGTCCAAGGGTTTG
GGCCGCGAGCGCGGCGAGGGCGTCCACATACCGACGGCCTGCGCCCTCGTCCGCACCTGGCTCGACGGCCTCAAG
GGGAAGCAGCTCGTCAGGCTGGACACGCTGCGGGTCGAGGTGCTGCTGCTGCATGCGCGGCGCATGATGACGCCC
CGCGCCGAGGATCTATGGACCCAGCTCGGCTCCGTCGTTCGCATGGCCATGACCATGGGCATGCACCGGGACCCG
CTCGAGTGCGAGCCCCGCATGACCGTCTTTGTCGGCGAGCTCCGGAGGAGACTGTGGTTCACCATCGTCGACACC
GACGTGCTCATGTCGCTTGCTTGCAGCCTGCCCTCCCTGATCCGCGACGGTGACTTTTCCTGCCGCCCGCCGCGC
AATCTCAACGACTCGGACCTGTTCCCCGCCATGGAGGAGCTGCCTCCGTCGAAGCCGATGGACCAGACGACGGAC
AACCAGATGCAGGTCTACTCGGCCGTGACGCTGGCGACGCGCATGCGCGTGCCGCCCATCGTCAACCGCCTCGAC
GCCCTGCGCGACTACCAGGAGGTGGTCGAGGTAGGCGCCAAGCTGGAGCGGCTCATCGACGACATCAACTTCGTC
TTACCCCGCCACAGCCTTTCCAACGACTCGCAGAAGAGCAGGGAGTGGAGGAGCCGCGTCGTTCTCGACATGCAC
GTCCGGCGGCCGCTGCTTGCCCTGTACCGGCCGCTCGCCATGGGCGTGCCGGACGTGCCGCCGCAGATTATGCGG
GCCTACCTGAGGTCGTCGATGGTGATTCTCAAGTACCTCGACGAGCTCGACCCCCATCTGGCGCACTTCCAGGAC
ATCGTCGAGATGTATCACCAGGTTCTGAAGCGGGAAATCATTCAGGCGGCCATGAGCGTCTGCTTTTACATCCAG
TCGGCGGTGCGGCCCAACTCGGAGGGCTTCGTCGTGGGCCGGCAGGCACTACGCATGTCGCCCAACGGCTCGGAC
GGCTACCCGTCAGACAGGGCCGAGGAGCTGGTGCTGTGGTCTCCGGGCCGCCTCATCAACACGGTGCAGAATACG
GTGAACCTGCTGGTGGCGCACATGAGCGGAAGCGACACCAAGGATGTCGTCCTGCTCACTCTCGTTCTGGAGACG
GTCAAGTCGGCGGAGCCCAAGGCGCAGGAAGTGGTCCGCGAGCTACACAGGCTACTGGAAGCCTGCCTCAAGGCG
ACGGGCCTGACGAGGGAGAAGCTGCACGGATGCTACGCAGCGGACGGCGGCTACGGTCACGGCCGGCCGTCGTAC
GGATTCGGCGGTCACCGGGCGTCTGTCAGCGGTAACAGCGCGGGCAAGGAAGACGGGGCGTGGATTCTGTGGGAT
GGATGGGATTGA
Gene >Ophio5|8071
ATGCCCGCAGCGTCAAGCGGCCCAGGCCCGTCAAGTCCTGCACCGAATGCCGCAAGCGCAAGCTACGATGTGATC
GCCTGCTGCCTTGCTCCCAGTGCCAAAAGTCCAGTCGCGGCTGCCGCTACGCCGCCGATCAAGACTCGGGCAACC
TCTCGGATGCCTCCGACGCTGAGACGGTCGAGCCCAGCCGTCCTTTCAAGCGCAACTGCCCCTCCATCTCGTCTG
GCGCTGCCATCAACGCCACCAGCGACATCGCTCACGCCGCCACCAGGAGCGGCGACTCCCCGAAACCGCCTTTTC
TCGAAGAATTGTGGCTGCGCATGGATCGTCTGGAGAAATACGTCCGCGCCCGCAGCCCAGGCACCGACGTCAGCG
GCGGGAGGGCCATTGCCGCGCCGCCCAACACCACCAGGGCCGTGTCCGTCAAGGCTGGCGCTCAGCAGACACGCT
TCTTTGGCCAGAACAGCACCCGCGTCTTGATGAACCTGGTGAGTCTCTAACCCGGGGTGAATTCGGCTCCCCACT
TACGCCTTCGCCCGCCTAGTTCGACGACGCCAAGGCCTTCCTTGACCCCCAGCAAGGCCCCTTGACCAACTCGGA
TCTTCTGCACGATCTTGGCACCTTGCACAGGAGTCTGCAGGATACCTTGCGCGATGCCTTGACGCCCATCACCGT
CTTCGTCGACTCCATGATGCCCGTCCAGAAGCGGATGACGGACATCTTGCCCAGCAAGGCCGTCTGCGACCGAAT
GGTGGCCTCGTACTTTGAGGTGGCCGAGACCATCTTTCGCATCGTCCACAAGCCTACCTTCTTCGACGAATACGA
TCTCTACTGGGAGGGCAAGCTTCAGTCAGAATCCTTCCTCCCCCAGCTGCTGGCCATGGTCTCCATTGCCTCGCG
CTTCGAGACCAAGTCCAAGGGTTTGGGCCGCGAGCGCGGCGAGGGCGTCCACATACCGACGGCCTGCGCCCTCGT
CCGCACCTGGCTCGACGGCCTCAAGGGGAAGCAGCTCGTCAGGCTGGACACGCTGCGGGTCGAGGTGCTGCTGCT
GCATGCGCGGCGCATGATGACGCCCCGCGCCGAGGATCTATGGACCCAGCTCGGCTCCGTCGTTCGCATGGCCAT
GACCATGGGCATGCACCGGGACCCGCTCGAGTGCGAGCCCCGCATGACCGTCTTTGTCGGCGAGCTCCGGAGGAG
ACTGTGGTTCACCATCGTCGACACCGACGTGCTCATGTCGCTTGCTTGCAGCCTGCCCTCCCTGATCCGCGACGG
TGACTTTTCCTGCCGCCCGCCGCGCAATCTCAACGACTCGGACCTGTTCCCCGCCATGGAGGAGCTGCCTCCGTC
GAAGCCGATGGACCAGACGACGGACAACCAGATGCAGGTCTACTCGGCCGTGACGCTGGCGACGCGCATGCGCGT
GCCGCCCATCGTCAACCGCCTCGACGCCCTGCGCGACTACCAGGAGGTGGTCGAGGTAGGCGCCAAGCTGGAGCG
GCTCATCGACGACATCAACTTCGTCTTACCCCGCCACAGCCTTTCCAACGACTCGCAGAAGAGCAGGGAGTGGAG
GAGCCGCGTCGTTCTCGACATGCACGTCCGGCGGCCGCTGCTTGCCCTGTACCGGCCGCTCGCCATGGGCGTGCC
GGACGTGCCGCCGCAGATTATGCGGGCCTACCTGAGGTCGTCGATGGTGATTCTCAAGTACCTCGACGAGCTCGA
CCCCCATCTGGCGCACTTCCAGGACATCGTCGAGATGTATCACCAGGTTCTGAAGCGGGAAATCATTCAGGCGGC
CATGAGCGTCTGCTTTTACATCCAGTCGGCGGTGCGGCCCAACTCGGAGGGCTTCGTCGTGGGCCGGCAGGCACT
ACGCATGTCGCCCAACGGCTCGGACGGCTACCCGTCAGACAGGGCCGAGGAGCTGGTGCTGTGGTCTCCGGGCCG
CCTCATCAACACGGTGCAGAATACGGTGAACCTGCTGGTGGCGCACATGAGCGGAAGCGACACCAAGGATGTCGT
CCTGCTCACTCTCGTTCTGGAGACGGTCAAGTCGGCGGAGCCCAAGGCGCAGGAAGTGGTCCGCGAGCTACACAG
GCTACTGGAAGCCTGCCTCAAGGCGACGGGCCTGACGAGGGAGAAGCTGCACGGATGCTACGCAGCGGACGGCGG
CTACGGTCACGGCCGGCCGTCGTACGGATTCGGCGGTCACCGGGCGTCTGTCAGCGGTAACAGCGCGGGCAAGGA
AGACGGGGCGTGGATTCTGTGGGATGGATGGGATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail