Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8055
Gene name
Locationscaffold_85:21462..22527
Strand+
Gene length (bp)1065
Transcript length (bp)1065
Coding sequence length (bp)1062
Protein length (aa) 354

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06391 MAT1 CDK-activating kinase assembly factor MAT1 1.6E-29 75 236
PF17121 zf-C3HC4_5 Zinc finger, C3HC4 type (RING finger) 4.0E-28 22 72

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q03290|TFB3_YEAST RNA polymerase II transcription factor B subunit 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TFB3 PE=1 SV=1 25 334 1.0E-51
sp|Q6BP96|TFB3_DEBHA RNA polymerase II transcription factor B subunit 3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TFB3 PE=3 SV=2 23 336 1.0E-51
sp|Q75D20|TFB3_ASHGO RNA polymerase II transcription factor B subunit 3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TFB3 PE=3 SV=1 20 334 1.0E-50
sp|Q6CT73|TFB3_KLULA RNA polymerase II transcription factor B subunit 3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TFB3 PE=3 SV=1 20 334 7.0E-50
sp|Q6FMP4|TFB3_CANGA RNA polymerase II transcription factor B subunit 3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TFB3 PE=3 SV=1 4 334 2.0E-48
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q03290|TFB3_YEAST RNA polymerase II transcription factor B subunit 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TFB3 PE=1 SV=1 25 334 1.0E-51
sp|Q6BP96|TFB3_DEBHA RNA polymerase II transcription factor B subunit 3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TFB3 PE=3 SV=2 23 336 1.0E-51
sp|Q75D20|TFB3_ASHGO RNA polymerase II transcription factor B subunit 3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TFB3 PE=3 SV=1 20 334 1.0E-50
sp|Q6CT73|TFB3_KLULA RNA polymerase II transcription factor B subunit 3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TFB3 PE=3 SV=1 20 334 7.0E-50
sp|Q6FMP4|TFB3_CANGA RNA polymerase II transcription factor B subunit 3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TFB3 PE=3 SV=1 4 334 2.0E-48
sp|Q6C7D0|TFB3_YARLI RNA polymerase II transcription factor B subunit 3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TFB3 PE=3 SV=1 23 329 1.0E-46
sp|O94684|TFB3_SCHPO RNA polymerase II transcription factor B subunit 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmh1 PE=1 SV=1 22 327 2.0E-41
sp|P51950|MAT1_MARGL CDK-activating kinase assembly factor MAT1 OS=Marthasterias glacialis PE=1 SV=1 21 336 2.0E-27
sp|P51948|MAT1_HUMAN CDK-activating kinase assembly factor MAT1 OS=Homo sapiens GN=MNAT1 PE=1 SV=1 21 327 4.0E-27
sp|P51949|MAT1_MOUSE CDK-activating kinase assembly factor MAT1 OS=Mus musculus GN=Mnat1 PE=1 SV=2 21 327 6.0E-27
sp|P51951|MAT1_XENLA CDK-activating kinase assembly factor MAT1 OS=Xenopus laevis GN=mnat1 PE=2 SV=1 21 327 2.0E-25
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8055
MSRGGSLVSAGHGSGPPAPDEDETCPVCKTTRYFNRDMEFRINPECYHRMCKTCVERIFKDGPNQCPYAGCHKTL
RLRGFKAAFFADLTVEREVDIRRRVAAVFNKVEDDFEDLEGYNDYLYMVECLTDDLVAGAPEARSKAEGQLADWE
AKHRADIERNRRLARESDEARSRRLAAENDAAKQRRLQDLREEADEKVTAARFREEMLDSLQSADVGHAAQAVDK
VLLKKRGQQRRQAAVSAASGTASGLSIRGLRDKTKPVVDDGPYDPFAGLNLAPSRVDLSAERLREYHSEWINVIR
SKDEYLVGGYSTDEYISRAMFEAFSGLGVFIADDKTEKSLPSATATQMGTDQAS
Coding >Ophio5|8055
ATGTCGCGCGGCGGCAGCCTCGTCTCCGCCGGGCACGGCTCTGGGCCTCCAGCTCCGGACGAAGACGAAACATGC
CCCGTCTGCAAGACGACGCGCTACTTCAACAGAGACATGGAGTTCCGCATCAACCCGGAATGCTACCACCGCATG
TGCAAAACCTGCGTCGAGCGCATCTTCAAAGACGGGCCTAACCAGTGTCCCTACGCCGGCTGCCACAAGACACTT
CGGCTGCGTGGGTTCAAGGCTGCCTTCTTCGCTGACTTGACTGTCGAGCGAGAGGTTGATATCCGGCGACGTGTC
GCGGCCGTCTTCAACAAGGTCGAGGATGACTTTGAGGATCTGGAAGGTTATAATGATTATCTATACATGGTAGAG
TGTCTGACGGATGATTTGGTCGCGGGCGCGCCTGAGGCGAGGTCCAAGGCAGAAGGTCAACTCGCAGACTGGGAA
GCCAAACATCGGGCTGACATCGAGCGCAATCGTCGACTGGCGCGCGAATCAGACGAGGCGCGCAGCCGGCGCCTC
GCCGCCGAGAACGACGCAGCCAAACAACGTCGGCTACAAGACCTGCGCGAAGAGGCTGATGAAAAAGTCACGGCC
GCACGCTTCCGCGAGGAGATGCTCGACTCTTTACAGAGCGCAGATGTCGGTCACGCCGCACAGGCCGTCGACAAG
GTCCTCCTCAAGAAGCGCGGCCAGCAACGTCGCCAGGCTGCCGTGTCTGCCGCGAGCGGAACCGCGTCGGGCTTG
TCTATCCGCGGCCTGCGCGATAAGACGAAACCTGTCGTCGACGATGGACCCTACGACCCCTTCGCTGGCCTGAAT
CTCGCTCCCAGCCGTGTTGACCTCTCGGCAGAGCGGCTGCGCGAGTATCACAGCGAGTGGATCAACGTCATCCGC
TCTAAGGACGAGTACCTAGTTGGGGGTTACAGCACAGATGAGTATATTTCTCGAGCCATGTTCGAGGCCTTTTCT
GGGCTGGGCGTCTTCATCGCCGACGATAAAACCGAAAAGTCTTTGCCGTCTGCCACCGCCACCCAAATGGGCACG
GACCAGGCTTCA
Transcript >Ophio5|8055
ATGTCGCGCGGCGGCAGCCTCGTCTCCGCCGGGCACGGCTCTGGGCCTCCAGCTCCGGACGAAGACGAAACATGC
CCCGTCTGCAAGACGACGCGCTACTTCAACAGAGACATGGAGTTCCGCATCAACCCGGAATGCTACCACCGCATG
TGCAAAACCTGCGTCGAGCGCATCTTCAAAGACGGGCCTAACCAGTGTCCCTACGCCGGCTGCCACAAGACACTT
CGGCTGCGTGGGTTCAAGGCTGCCTTCTTCGCTGACTTGACTGTCGAGCGAGAGGTTGATATCCGGCGACGTGTC
GCGGCCGTCTTCAACAAGGTCGAGGATGACTTTGAGGATCTGGAAGGTTATAATGATTATCTATACATGGTAGAG
TGTCTGACGGATGATTTGGTCGCGGGCGCGCCTGAGGCGAGGTCCAAGGCAGAAGGTCAACTCGCAGACTGGGAA
GCCAAACATCGGGCTGACATCGAGCGCAATCGTCGACTGGCGCGCGAATCAGACGAGGCGCGCAGCCGGCGCCTC
GCCGCCGAGAACGACGCAGCCAAACAACGTCGGCTACAAGACCTGCGCGAAGAGGCTGATGAAAAAGTCACGGCC
GCACGCTTCCGCGAGGAGATGCTCGACTCTTTACAGAGCGCAGATGTCGGTCACGCCGCACAGGCCGTCGACAAG
GTCCTCCTCAAGAAGCGCGGCCAGCAACGTCGCCAGGCTGCCGTGTCTGCCGCGAGCGGAACCGCGTCGGGCTTG
TCTATCCGCGGCCTGCGCGATAAGACGAAACCTGTCGTCGACGATGGACCCTACGACCCCTTCGCTGGCCTGAAT
CTCGCTCCCAGCCGTGTTGACCTCTCGGCAGAGCGGCTGCGCGAGTATCACAGCGAGTGGATCAACGTCATCCGC
TCTAAGGACGAGTACCTAGTTGGGGGTTACAGCACAGATGAGTATATTTCTCGAGCCATGTTCGAGGCCTTTTCT
GGGCTGGGCGTCTTCATCGCCGACGATAAAACCGAAAAGTCTTTGCCGTCTGCCACCGCCACCCAAATGGGCACG
GACCAGGCTTCATGA
Gene >Ophio5|8055
ATGTCGCGCGGCGGCAGCCTCGTCTCCGCCGGGCACGGCTCTGGGCCTCCAGCTCCGGACGAAGACGAAACATGC
CCCGTCTGCAAGACGACGCGCTACTTCAACAGAGACATGGAGTTCCGCATCAACCCGGAATGCTACCACCGCATG
TGCAAAACCTGCGTCGAGCGCATCTTCAAAGACGGGCCTAACCAGTGTCCCTACGCCGGCTGCCACAAGACACTT
CGGCTGCGTGGGTTCAAGGCTGCCTTCTTCGCTGACTTGACTGTCGAGCGAGAGGTTGATATCCGGCGACGTGTC
GCGGCCGTCTTCAACAAGGTCGAGGATGACTTTGAGGATCTGGAAGGTTATAATGATTATCTATACATGGTAGAG
TGTCTGACGGATGATTTGGTCGCGGGCGCGCCTGAGGCGAGGTCCAAGGCAGAAGGTCAACTCGCAGACTGGGAA
GCCAAACATCGGGCTGACATCGAGCGCAATCGTCGACTGGCGCGCGAATCAGACGAGGCGCGCAGCCGGCGCCTC
GCCGCCGAGAACGACGCAGCCAAACAACGTCGGCTACAAGACCTGCGCGAAGAGGCTGATGAAAAAGTCACGGCC
GCACGCTTCCGCGAGGAGATGCTCGACTCTTTACAGAGCGCAGATGTCGGTCACGCCGCACAGGCCGTCGACAAG
GTCCTCCTCAAGAAGCGCGGCCAGCAACGTCGCCAGGCTGCCGTGTCTGCCGCGAGCGGAACCGCGTCGGGCTTG
TCTATCCGCGGCCTGCGCGATAAGACGAAACCTGTCGTCGACGATGGACCCTACGACCCCTTCGCTGGCCTGAAT
CTCGCTCCCAGCCGTGTTGACCTCTCGGCAGAGCGGCTGCGCGAGTATCACAGCGAGTGGATCAACGTCATCCGC
TCTAAGGACGAGTACCTAGTTGGGGGTTACAGCACAGATGAGTATATTTCTCGAGCCATGTTCGAGGCCTTTTCT
GGGCTGGGCGTCTTCATCGCCGACGATAAAACCGAAAAGTCTTTGCCGTCTGCCACCGCCACCCAAATGGGCACG
GACCAGGCTTCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail