Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8049
Gene name
Locationscaffold_85:12821..13709
Strand+
Gene length (bp)888
Transcript length (bp)834
Coding sequence length (bp)831
Protein length (aa) 277

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00406 ADK Adenylate kinase 3.9E-18 11 84
PF00406 ADK Adenylate kinase 1.2E-11 142 250
PF05191 ADK_lid Adenylate kinase, active site lid 2.8E-13 187 222
PF13207 AAA_17 AAA domain 8.1E-10 12 81

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|E9P974|KAD3_YEASX GTP:AMP phosphotransferase, mitochondrial OS=Saccharomyces cerevisiae GN=ADK2 PE=1 SV=1 13 276 4.0E-44
sp|P26364|KAD3_YEAST GTP:AMP phosphotransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADK2 PE=1 SV=1 13 263 1.0E-41
sp|Q9WUR9|KAD4_MOUSE Adenylate kinase 4, mitochondrial OS=Mus musculus GN=Ak4 PE=1 SV=1 8 276 3.0E-40
sp|Q9WUS0|KAD4_RAT Adenylate kinase 4, mitochondrial OS=Rattus norvegicus GN=Ak4 PE=2 SV=1 8 276 4.0E-40
sp|Q0VCP1|KAD4_BOVIN Adenylate kinase 4, mitochondrial OS=Bos taurus GN=AK4 PE=2 SV=1 8 276 6.0E-40
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|E9P974|KAD3_YEASX GTP:AMP phosphotransferase, mitochondrial OS=Saccharomyces cerevisiae GN=ADK2 PE=1 SV=1 13 276 4.0E-44
sp|P26364|KAD3_YEAST GTP:AMP phosphotransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADK2 PE=1 SV=1 13 263 1.0E-41
sp|Q9WUR9|KAD4_MOUSE Adenylate kinase 4, mitochondrial OS=Mus musculus GN=Ak4 PE=1 SV=1 8 276 3.0E-40
sp|Q9WUS0|KAD4_RAT Adenylate kinase 4, mitochondrial OS=Rattus norvegicus GN=Ak4 PE=2 SV=1 8 276 4.0E-40
sp|Q0VCP1|KAD4_BOVIN Adenylate kinase 4, mitochondrial OS=Bos taurus GN=AK4 PE=2 SV=1 8 276 6.0E-40
sp|A1W895|KAD_ACISJ Adenylate kinase OS=Acidovorax sp. (strain JS42) GN=adk PE=3 SV=1 8 247 3.0E-38
sp|B9MI80|KAD_ACIET Adenylate kinase OS=Acidovorax ebreus (strain TPSY) GN=adk PE=3 SV=1 8 247 3.0E-38
sp|P08760|KAD3_BOVIN GTP:AMP phosphotransferase AK3, mitochondrial OS=Bos taurus GN=AK3 PE=1 SV=3 5 268 3.0E-38
sp|Q9UIJ7|KAD3_HUMAN GTP:AMP phosphotransferase AK3, mitochondrial OS=Homo sapiens GN=AK3 PE=1 SV=4 5 268 9.0E-38
sp|Q5RDZ0|KAD3_PONAB GTP:AMP phosphotransferase AK3, mitochondrial OS=Pongo abelii GN=AK3 PE=2 SV=3 5 268 1.0E-37
sp|A4SVI8|KAD_POLSQ Adenylate kinase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=adk PE=3 SV=1 8 247 1.0E-37
sp|Q9WTP7|KAD3_MOUSE GTP:AMP phosphotransferase AK3, mitochondrial OS=Mus musculus GN=Ak3 PE=1 SV=3 5 274 1.0E-37
sp|C1D6J0|KAD_LARHH Adenylate kinase OS=Laribacter hongkongensis (strain HLHK9) GN=adk PE=3 SV=1 8 247 4.0E-37
sp|B1KNK5|KAD_SHEWM Adenylate kinase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=adk PE=3 SV=1 8 247 3.0E-36
sp|P29411|KAD3_RAT GTP:AMP phosphotransferase AK3, mitochondrial OS=Rattus norvegicus GN=Ak3 PE=2 SV=2 5 274 3.0E-36
sp|Q5QWR3|KAD_IDILO Adenylate kinase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=adk PE=3 SV=1 8 248 4.0E-36
sp|Q4ZWV2|KAD_PSEU2 Adenylate kinase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=adk PE=3 SV=1 8 248 6.0E-36
sp|Q4KHK4|KAD_PSEF5 Adenylate kinase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=adk PE=3 SV=1 8 248 7.0E-36
sp|Q886R8|KAD_PSESM Adenylate kinase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=adk PE=3 SV=1 8 248 1.0E-35
sp|B1XTC5|KAD_POLNS Adenylate kinase OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=adk PE=3 SV=1 8 247 1.0E-35
sp|Q1LR08|KAD_CUPMC Adenylate kinase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=adk PE=3 SV=1 8 271 5.0E-35
sp|Q08479|KAD3_ORYSJ Adenylate kinase 3 OS=Oryza sativa subsp. japonica GN=ADK-A PE=2 SV=1 8 252 5.0E-35
sp|Q21II4|KAD_SACD2 Adenylate kinase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=adk PE=3 SV=1 8 268 7.0E-35
sp|Q475G1|KAD_CUPPJ Adenylate kinase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=adk PE=3 SV=1 8 271 1.0E-34
sp|C3LTN4|KAD_VIBCM Adenylate kinase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=adk PE=3 SV=1 8 249 2.0E-34
sp|Q9KTB7|KAD_VIBCH Adenylate kinase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=adk PE=1 SV=1 8 249 2.0E-34
sp|A5F2U0|KAD_VIBC3 Adenylate kinase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=adk PE=3 SV=1 8 249 2.0E-34
sp|Q0A982|KAD_ALKEH Adenylate kinase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=adk PE=3 SV=1 8 247 2.0E-34
sp|Q6CK57|KAD2_KLULA Adenylate kinase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ADK1 PE=3 SV=1 6 256 2.0E-34
sp|A1K5I5|KAD_AZOSB Adenylate kinase OS=Azoarcus sp. (strain BH72) GN=adk PE=3 SV=1 8 247 2.0E-34
sp|Q0KE20|KAD_CUPNH Adenylate kinase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=adk PE=3 SV=1 8 271 2.0E-34
sp|B2UB85|KAD_RALPJ Adenylate kinase OS=Ralstonia pickettii (strain 12J) GN=adk PE=3 SV=1 8 271 5.0E-34
sp|Q31DX5|KAD_THICR Adenylate kinase OS=Thiomicrospira crunogena (strain XCL-2) GN=adk PE=3 SV=1 8 246 6.0E-34
sp|Q12PB0|KAD_SHEDO Adenylate kinase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=adk PE=3 SV=1 8 247 9.0E-34
sp|Q129C6|KAD_POLSJ Adenylate kinase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=adk PE=3 SV=1 8 247 1.0E-33
sp|A1S566|KAD_SHEAM Adenylate kinase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=adk PE=3 SV=1 8 248 1.0E-33
sp|C5CKV9|KAD_VARPS Adenylate kinase OS=Variovorax paradoxus (strain S110) GN=adk PE=3 SV=1 8 247 1.0E-33
sp|B8CN03|KAD_SHEPW Adenylate kinase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=adk PE=3 SV=1 8 247 1.0E-33
sp|Q21TN6|KAD_RHOFT Adenylate kinase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=adk PE=3 SV=1 8 247 2.0E-33
sp|B0TP07|KAD_SHEHH Adenylate kinase OS=Shewanella halifaxensis (strain HAW-EB4) GN=adk PE=3 SV=1 8 247 2.0E-33
sp|Q3KHE3|KAD_PSEPF Adenylate kinase OS=Pseudomonas fluorescens (strain Pf0-1) GN=adk PE=3 SV=1 8 246 2.0E-33
sp|Q8XWE1|KAD_RALSO Adenylate kinase OS=Ralstonia solanacearum (strain GMI1000) GN=adk PE=3 SV=1 8 247 4.0E-33
sp|B2VHX2|KAD_ERWT9 Adenylate kinase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=adk PE=3 SV=1 8 249 4.0E-33
sp|Q5P106|KAD_AROAE Adenylate kinase OS=Aromatoleum aromaticum (strain EbN1) GN=adk PE=3 SV=1 8 248 5.0E-33
sp|B3R0X7|KAD_CUPTR Adenylate kinase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=adk PE=3 SV=1 8 271 5.0E-33
sp|A3QF48|KAD_SHELP Adenylate kinase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=adk PE=3 SV=1 8 248 7.0E-33
sp|A7E8H8|KAD2_SCLS1 Adenylate kinase OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=adk1 PE=3 SV=1 8 256 7.0E-33
sp|Q606F1|KAD_METCA Adenylate kinase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=adk PE=3 SV=1 8 249 8.0E-33
sp|A8AJW9|KAD_CITK8 Adenylate kinase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=adk PE=3 SV=1 8 249 9.0E-33
sp|A6T169|KAD_JANMA Adenylate kinase OS=Janthinobacterium sp. (strain Marseille) GN=adk PE=3 SV=1 8 246 9.0E-33
sp|B7M3W6|KAD_ECO8A Adenylate kinase OS=Escherichia coli O8 (strain IAI1) GN=adk PE=3 SV=1 8 249 1.0E-32
sp|Q83M40|KAD_SHIFL Adenylate kinase OS=Shigella flexneri GN=adk PE=3 SV=4 8 249 1.0E-32
sp|C6DB87|KAD_PECCP Adenylate kinase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=adk PE=3 SV=1 8 249 1.0E-32
sp|Q74ZL1|KAD2_ASHGO Adenylate kinase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ADK1 PE=3 SV=1 6 256 1.0E-32
sp|Q8FK84|KAD_ECOL6 Adenylate kinase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=adk PE=3 SV=2 8 249 1.0E-32
sp|Q0TKG7|KAD_ECOL5 Adenylate kinase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=adk PE=3 SV=1 8 249 1.0E-32
sp|B7MQI9|KAD_ECO81 Adenylate kinase OS=Escherichia coli O81 (strain ED1a) GN=adk PE=3 SV=1 8 249 1.0E-32
sp|B7NIF6|KAD_ECO7I Adenylate kinase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=adk PE=3 SV=1 8 249 1.0E-32
sp|B7UKF4|KAD_ECO27 Adenylate kinase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=adk PE=3 SV=1 8 249 1.0E-32
sp|B7MDZ6|KAD_ECO45 Adenylate kinase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=adk PE=3 SV=1 8 249 1.0E-32
sp|Q0T7B1|KAD_SHIF8 Adenylate kinase OS=Shigella flexneri serotype 5b (strain 8401) GN=adk PE=3 SV=1 8 249 1.0E-32
sp|Q325C2|KAD_SHIBS Adenylate kinase OS=Shigella boydii serotype 4 (strain Sb227) GN=adk PE=3 SV=1 8 249 1.0E-32
sp|B2U4S7|KAD_SHIB3 Adenylate kinase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=adk PE=3 SV=1 8 249 1.0E-32
sp|B7LV13|KAD_ESCF3 Adenylate kinase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=adk PE=3 SV=1 8 249 1.0E-32
sp|B1LJN2|KAD_ECOSM Adenylate kinase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=adk PE=3 SV=1 8 249 1.0E-32
sp|B6I0C6|KAD_ECOSE Adenylate kinase OS=Escherichia coli (strain SE11) GN=adk PE=3 SV=1 8 249 1.0E-32
sp|B7N927|KAD_ECOLU Adenylate kinase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=adk PE=3 SV=1 8 249 1.0E-32
sp|P69441|KAD_ECOLI Adenylate kinase OS=Escherichia coli (strain K12) GN=adk PE=1 SV=1 8 249 1.0E-32
sp|B1IZC0|KAD_ECOLC Adenylate kinase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=adk PE=3 SV=1 8 249 1.0E-32
sp|A7ZXD2|KAD_ECOHS Adenylate kinase OS=Escherichia coli O9:H4 (strain HS) GN=adk PE=3 SV=1 8 249 1.0E-32
sp|B1XFR1|KAD_ECODH Adenylate kinase OS=Escherichia coli (strain K12 / DH10B) GN=adk PE=3 SV=1 8 249 1.0E-32
sp|C4ZUS8|KAD_ECOBW Adenylate kinase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=adk PE=3 SV=1 8 249 1.0E-32
sp|P69442|KAD_ECO57 Adenylate kinase OS=Escherichia coli O157:H7 GN=adk PE=3 SV=1 8 249 1.0E-32
sp|B7L799|KAD_ECO55 Adenylate kinase OS=Escherichia coli (strain 55989 / EAEC) GN=adk PE=3 SV=1 8 249 1.0E-32
sp|A7ZIN4|KAD_ECO24 Adenylate kinase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=adk PE=3 SV=1 8 249 1.0E-32
sp|Q2SL21|KAD_HAHCH Adenylate kinase OS=Hahella chejuensis (strain KCTC 2396) GN=adk PE=3 SV=1 8 268 2.0E-32
sp|A5DC72|KAD2_PICGU Adenylate kinase OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=ADK1 PE=3 SV=1 5 256 2.0E-32
sp|Q15RT7|KAD_PSEA6 Adenylate kinase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=adk PE=3 SV=1 8 267 2.0E-32
sp|Q5R421|KAD4_PONAB Adenylate kinase 4, mitochondrial OS=Pongo abelii GN=AK4 PE=2 SV=1 146 276 2.0E-32
sp|P27144|KAD4_HUMAN Adenylate kinase 4, mitochondrial OS=Homo sapiens GN=AK4 PE=1 SV=1 146 276 2.0E-32
sp|Q3Z4S5|KAD_SHISS Adenylate kinase OS=Shigella sonnei (strain Ss046) GN=adk PE=3 SV=1 8 249 3.0E-32
sp|A6RPU0|KAD2_BOTFB Adenylate kinase OS=Botryotinia fuckeliana (strain B05.10) GN=adk1 PE=3 SV=1 6 256 4.0E-32
sp|A2SIQ4|KAD_METPP Adenylate kinase OS=Methylibium petroleiphilum (strain PM1) GN=adk PE=3 SV=1 8 246 4.0E-32
sp|A4G7X8|KAD_HERAR Adenylate kinase OS=Herminiimonas arsenicoxydans GN=adk PE=3 SV=1 8 248 7.0E-32
sp|Q0VRB0|KAD_ALCBS Adenylate kinase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=adk PE=3 SV=1 8 246 8.0E-32
sp|A8GAV3|KAD_SERP5 Adenylate kinase OS=Serratia proteamaculans (strain 568) GN=adk PE=3 SV=1 8 249 8.0E-32
sp|A1VNK2|KAD_POLNA Adenylate kinase OS=Polaromonas naphthalenivorans (strain CJ2) GN=adk PE=3 SV=1 8 247 9.0E-32
sp|Q2NV57|KAD_SODGM Adenylate kinase OS=Sodalis glossinidius (strain morsitans) GN=adk PE=3 SV=1 8 249 1.0E-31
sp|B3PIE4|KAD_CELJU Adenylate kinase OS=Cellvibrio japonicus (strain Ueda107) GN=adk PE=3 SV=1 8 248 1.0E-31
sp|Q3ASD2|KAD_CHLCH Adenylate kinase OS=Chlorobium chlorochromatii (strain CaD3) GN=adk PE=3 SV=1 8 246 2.0E-31
sp|A1WSH6|KAD_VEREI Adenylate kinase OS=Verminephrobacter eiseniae (strain EF01-2) GN=adk PE=3 SV=1 8 247 2.0E-31
sp|Q5X5F4|KAD_LEGPA Adenylate kinase OS=Legionella pneumophila (strain Paris) GN=adk PE=3 SV=1 8 246 2.0E-31
sp|P49983|KADH_TRIVA Adenylate kinase OS=Trichomonas vaginalis PE=1 SV=1 4 268 2.0E-31
sp|A5IBQ3|KAD_LEGPC Adenylate kinase OS=Legionella pneumophila (strain Corby) GN=adk PE=3 SV=1 8 246 2.0E-31
sp|A6T5N7|KAD_KLEP7 Adenylate kinase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=adk PE=3 SV=1 8 249 2.0E-31
sp|B5Y0N3|KAD_KLEP3 Adenylate kinase OS=Klebsiella pneumoniae (strain 342) GN=adk PE=3 SV=1 8 249 2.0E-31
sp|Q5WWT7|KAD_LEGPL Adenylate kinase OS=Legionella pneumophila (strain Lens) GN=adk PE=3 SV=1 8 246 2.0E-31
sp|A1TQ96|KAD_ACIAC Adenylate kinase OS=Acidovorax citrulli (strain AAC00-1) GN=adk PE=3 SV=1 8 247 2.0E-31
sp|Q6D7Z5|KAD_PECAS Adenylate kinase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=adk PE=3 SV=1 8 249 3.0E-31
sp|Q9HXV4|KAD_PSEAE Adenylate kinase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=adk PE=3 SV=1 8 248 3.0E-31
sp|Q02RF8|KAD_PSEAB Adenylate kinase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=adk PE=3 SV=1 8 248 3.0E-31
sp|B7V109|KAD_PSEA8 Adenylate kinase OS=Pseudomonas aeruginosa (strain LESB58) GN=adk PE=3 SV=1 8 248 3.0E-31
sp|P0A1V4|KAD_SALTY Adenylate kinase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=adk PE=3 SV=1 8 249 3.0E-31
sp|P0A1V5|KAD_SALTI Adenylate kinase OS=Salmonella typhi GN=adk PE=3 SV=1 8 249 3.0E-31
sp|B4TMG6|KAD_SALSV Adenylate kinase OS=Salmonella schwarzengrund (strain CVM19633) GN=adk PE=3 SV=1 8 249 3.0E-31
sp|B5BD44|KAD_SALPK Adenylate kinase OS=Salmonella paratyphi A (strain AKU_12601) GN=adk PE=3 SV=1 8 249 3.0E-31
sp|C0Q812|KAD_SALPC Adenylate kinase OS=Salmonella paratyphi C (strain RKS4594) GN=adk PE=3 SV=1 8 249 3.0E-31
sp|Q5PFK8|KAD_SALPA Adenylate kinase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=adk PE=3 SV=1 8 249 3.0E-31
sp|B4SWY1|KAD_SALNS Adenylate kinase OS=Salmonella newport (strain SL254) GN=adk PE=3 SV=1 8 249 3.0E-31
sp|B4T9I1|KAD_SALHS Adenylate kinase OS=Salmonella heidelberg (strain SL476) GN=adk PE=3 SV=1 8 249 3.0E-31
sp|B5R612|KAD_SALG2 Adenylate kinase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=adk PE=3 SV=1 8 249 3.0E-31
sp|B5QU77|KAD_SALEP Adenylate kinase OS=Salmonella enteritidis PT4 (strain P125109) GN=adk PE=3 SV=1 8 249 3.0E-31
sp|B5FLJ7|KAD_SALDC Adenylate kinase OS=Salmonella dublin (strain CT_02021853) GN=adk PE=3 SV=1 8 249 3.0E-31
sp|Q57S76|KAD_SALCH Adenylate kinase OS=Salmonella choleraesuis (strain SC-B67) GN=adk PE=3 SV=1 8 249 3.0E-31
sp|B5EXN0|KAD_SALA4 Adenylate kinase OS=Salmonella agona (strain SL483) GN=adk PE=3 SV=1 8 249 3.0E-31
sp|B2T6M4|KAD_BURPP Adenylate kinase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=adk PE=3 SV=1 8 246 3.0E-31
sp|B2JDV1|KAD_BURP8 Adenylate kinase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=adk PE=3 SV=1 8 250 3.0E-31
sp|A6V1A1|KAD_PSEA7 Adenylate kinase OS=Pseudomonas aeruginosa (strain PA7) GN=adk PE=3 SV=1 8 248 4.0E-31
sp|A8PAA1|KAD2_COPC7 Adenylate kinase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=ADK1 PE=3 SV=1 8 260 6.0E-31
sp|B2CNY4|KAD2_TALMA Adenylate kinase OS=Talaromyces marneffei GN=adk1 PE=1 SV=1 8 256 6.0E-31
sp|A1U2U2|KAD_MARHV Adenylate kinase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=adk PE=3 SV=1 8 246 7.0E-31
sp|A9BWI1|KAD_DELAS Adenylate kinase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=adk PE=3 SV=1 8 246 7.0E-31
sp|B4RU55|KAD_ALTMD Adenylate kinase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=adk PE=3 SV=1 8 247 8.0E-31
sp|A4XXP5|KAD_PSEMY Adenylate kinase OS=Pseudomonas mendocina (strain ymp) GN=adk PE=3 SV=1 8 248 9.0E-31
sp|Q1GZB7|KAD_METFK Adenylate kinase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=adk PE=3 SV=1 8 247 9.0E-31
sp|Q3SIR8|KAD_THIDA Adenylate kinase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=adk PE=3 SV=1 8 247 1.0E-30
sp|A4W7F8|KAD_ENT38 Adenylate kinase OS=Enterobacter sp. (strain 638) GN=adk PE=3 SV=1 8 249 1.0E-30
sp|Q87RH4|KAD_VIBPA Adenylate kinase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=adk PE=3 SV=1 8 249 1.0E-30
sp|Q4PCS5|KAD2_USTMA Adenylate kinase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ADK1 PE=3 SV=3 6 263 1.0E-30
sp|Q0V3D5|KAD2_PHANO Adenylate kinase OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=ADK1 PE=3 SV=1 4 256 1.0E-30
sp|C4L8U2|KAD_TOLAT Adenylate kinase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=adk PE=3 SV=1 8 252 1.0E-30
sp|A9L567|KAD_SHEB9 Adenylate kinase OS=Shewanella baltica (strain OS195) GN=adk PE=3 SV=1 8 248 2.0E-30
sp|A6WPI0|KAD_SHEB8 Adenylate kinase OS=Shewanella baltica (strain OS185) GN=adk PE=3 SV=1 8 248 2.0E-30
sp|A3D5M6|KAD_SHEB5 Adenylate kinase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=adk PE=3 SV=1 8 248 2.0E-30
sp|B8E732|KAD_SHEB2 Adenylate kinase OS=Shewanella baltica (strain OS223) GN=adk PE=3 SV=1 8 248 2.0E-30
sp|O82514|KAD4_ARATH Adenylate kinase 4 OS=Arabidopsis thaliana GN=ADK1 PE=1 SV=2 8 255 2.0E-30
sp|Q2GVK6|KAD2_CHAGB Adenylate kinase OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=ADK1 PE=3 SV=1 8 256 2.0E-30
sp|A1RIQ3|KAD_SHESW Adenylate kinase OS=Shewanella sp. (strain W3-18-1) GN=adk PE=3 SV=1 8 248 2.0E-30
sp|A4Y7T5|KAD_SHEPC Adenylate kinase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=adk PE=3 SV=1 8 248 2.0E-30
sp|Q5A4Q1|KAD2_CANAL Adenylate kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ADK1 PE=3 SV=2 5 256 2.0E-30
sp|C5BD16|KAD_EDWI9 Adenylate kinase OS=Edwardsiella ictaluri (strain 93-146) GN=adk PE=3 SV=1 8 249 2.0E-30
sp|Q8DFM1|KAD_VIBVU Adenylate kinase OS=Vibrio vulnificus (strain CMCP6) GN=adk PE=3 SV=1 8 249 3.0E-30
sp|Q7MMR5|KAD_VIBVY Adenylate kinase OS=Vibrio vulnificus (strain YJ016) GN=adk PE=3 SV=1 8 249 3.0E-30
sp|Q8EFF5|KAD_SHEON Adenylate kinase OS=Shewanella oneidensis (strain MR-1) GN=adk PE=3 SV=1 8 248 3.0E-30
sp|Q0HU97|KAD_SHESR Adenylate kinase OS=Shewanella sp. (strain MR-7) GN=adk PE=3 SV=1 8 248 3.0E-30
sp|Q0HHZ7|KAD_SHESM Adenylate kinase OS=Shewanella sp. (strain MR-4) GN=adk PE=3 SV=1 8 248 3.0E-30
sp|A0KY01|KAD_SHESA Adenylate kinase OS=Shewanella sp. (strain ANA-3) GN=adk PE=3 SV=1 8 248 3.0E-30
sp|C1DSX5|KAD_AZOVD Adenylate kinase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=adk PE=3 SV=1 8 248 3.0E-30
sp|A7MT47|KAD_VIBCB Adenylate kinase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=adk PE=3 SV=1 8 249 3.0E-30
sp|B2A4G2|KAD_NATTJ Adenylate kinase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=adk PE=3 SV=1 8 262 4.0E-30
sp|Q48F36|KAD_PSE14 Adenylate kinase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=adk PE=3 SV=1 8 248 5.0E-30
sp|Q32J54|KAD_SHIDS Adenylate kinase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=adk PE=3 SV=1 8 249 5.0E-30
sp|Q13UR8|KAD_BURXL Adenylate kinase OS=Burkholderia xenovorans (strain LB400) GN=adk PE=3 SV=1 8 246 5.0E-30
sp|Q250L1|KAD_DESHY Adenylate kinase OS=Desulfitobacterium hafniense (strain Y51) GN=adk PE=3 SV=1 8 257 5.0E-30
sp|B8G1Y7|KAD_DESHD Adenylate kinase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=adk PE=3 SV=1 8 257 5.0E-30
sp|B7VII5|KAD_VIBTL Adenylate kinase OS=Vibrio tasmaniensis (strain LGP32) GN=adk PE=3 SV=1 8 249 8.0E-30
sp|Q4WJ21|KAD2_ASPFU Adenylate kinase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=adk1 PE=3 SV=1 8 256 9.0E-30
sp|B0XPW9|KAD2_ASPFC Adenylate kinase OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=adk1 PE=3 SV=1 8 256 9.0E-30
sp|A1JNB1|KAD_YERE8 Adenylate kinase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=adk PE=3 SV=1 8 249 9.0E-30
sp|J7RC67|KAD_BORP1 Adenylate kinase OS=Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) GN=adk PE=1 SV=1 8 247 1.0E-29
sp|Q7WKU8|KAD_BORBR Adenylate kinase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=adk PE=3 SV=1 8 247 1.0E-29
sp|B2B0E2|KAD2_PODAN Adenylate kinase OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=ADK1 PE=3 SV=1 8 256 1.0E-29
sp|B4F1Q2|KAD_PROMH Adenylate kinase OS=Proteus mirabilis (strain HI4320) GN=adk PE=3 SV=1 8 246 1.0E-29
sp|A5E598|KAD2_LODEL Adenylate kinase OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=ADK1 PE=3 SV=1 5 256 1.0E-29
sp|A7THY5|KAD2_VANPO Adenylate kinase OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=ADK1 PE=3 SV=1 8 256 1.0E-29
sp|Q7NSS7|KAD_CHRVO Adenylate kinase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=adk PE=3 SV=1 8 248 1.0E-29
sp|Q1QZ94|KAD_CHRSD Adenylate kinase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=adk PE=3 SV=1 8 246 1.0E-29
sp|B1Y6I7|KAD_LEPCP Adenylate kinase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=adk PE=3 SV=1 8 247 2.0E-29
sp|A1WXY6|KAD_HALHL Adenylate kinase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=adk PE=3 SV=1 8 248 2.0E-29
sp|E6MY99|KAD_NEIMH Adenylate kinase OS=Neisseria meningitidis serogroup B / serotype 15 (strain H44/76) GN=adk PE=3 SV=1 8 248 2.0E-29
sp|P0A0U7|KAD_NEIMB Adenylate kinase OS=Neisseria meningitidis serogroup B (strain MC58) GN=adk PE=3 SV=1 8 248 2.0E-29
sp|A1D3M8|KAD2_NEOFI Adenylate kinase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=adk1 PE=3 SV=1 8 256 2.0E-29
sp|A1KT73|KAD_NEIMF Adenylate kinase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=adk PE=3 SV=1 8 248 2.0E-29
sp|P0DH56|KAD_NEIME Adenylate kinase OS=Neisseria meningitidis GN=adk PE=3 SV=1 8 248 2.0E-29
sp|P0A0U6|KAD_NEIMA Adenylate kinase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=adk PE=3 SV=1 8 248 2.0E-29
sp|A9M3Q2|KAD_NEIM0 Adenylate kinase OS=Neisseria meningitidis serogroup C (strain 053442) GN=adk PE=3 SV=1 8 248 2.0E-29
sp|Q084C4|KAD_SHEFN Adenylate kinase OS=Shewanella frigidimarina (strain NCIMB 400) GN=adk PE=3 SV=1 8 248 2.0E-29
sp|Q2KZE4|KAD_BORA1 Adenylate kinase OS=Bordetella avium (strain 197N) GN=adk PE=3 SV=1 8 247 2.0E-29
sp|A0PXW7|KAD_CLONN Adenylate kinase OS=Clostridium novyi (strain NT) GN=adk PE=3 SV=1 8 260 3.0E-29
sp|C4K7W8|KAD_HAMD5 Adenylate kinase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=adk PE=3 SV=1 8 267 3.0E-29
sp|A1CQR5|KAD2_ASPCL Adenylate kinase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=adk1 PE=3 SV=1 8 256 3.0E-29
sp|A2QPN9|KAD2_ASPNC Adenylate kinase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=adk1 PE=3 SV=1 8 256 3.0E-29
sp|Q47B46|KAD_DECAR Adenylate kinase OS=Dechloromonas aromatica (strain RCB) GN=adk PE=3 SV=1 8 248 3.0E-29
sp|B1JHN1|KAD_YERPY Adenylate kinase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=adk PE=3 SV=1 8 249 3.0E-29
sp|Q66DP7|KAD_YERPS Adenylate kinase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=adk PE=3 SV=1 8 249 3.0E-29
sp|A4TPA4|KAD_YERPP Adenylate kinase OS=Yersinia pestis (strain Pestoides F) GN=adk PE=3 SV=1 8 249 3.0E-29
sp|Q1CL27|KAD_YERPN Adenylate kinase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=adk PE=3 SV=1 8 249 3.0E-29
sp|A9R0Q7|KAD_YERPG Adenylate kinase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=adk PE=3 SV=1 8 249 3.0E-29
sp|O69172|KAD_YERPE Adenylate kinase OS=Yersinia pestis GN=adk PE=3 SV=1 8 249 3.0E-29
sp|B2K6Z6|KAD_YERPB Adenylate kinase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=adk PE=3 SV=1 8 249 3.0E-29
sp|Q1C4P9|KAD_YERPA Adenylate kinase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=adk PE=3 SV=1 8 249 3.0E-29
sp|A7FL86|KAD_YERP3 Adenylate kinase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=adk PE=3 SV=1 8 249 3.0E-29
sp|A3LV51|KAD2_PICST Adenylate kinase OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ADK1 PE=3 SV=1 5 257 4.0E-29
sp|Q8AVD3|KAD2_XENLA Adenylate kinase 2, mitochondrial OS=Xenopus laevis GN=ak2 PE=2 SV=1 8 263 4.0E-29
sp|B3QNN0|KAD_CHLP8 Adenylate kinase OS=Chlorobaculum parvum (strain NCIB 8327) GN=adk PE=3 SV=1 8 246 4.0E-29
sp|Q7W7G0|KAD_BORPA Adenylate kinase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=adk PE=3 SV=1 8 247 4.0E-29
sp|A6VUQ6|KAD_MARMS Adenylate kinase OS=Marinomonas sp. (strain MWYL1) GN=adk PE=3 SV=1 8 246 5.0E-29
sp|A1BGN6|KAD_CHLPD Adenylate kinase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=adk PE=3 SV=1 8 246 5.0E-29
sp|Q6BLN9|KAD2_DEBHA Adenylate kinase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ADK1 PE=3 SV=1 5 256 6.0E-29
sp|P43412|KAD_YEREN Adenylate kinase OS=Yersinia enterocolitica GN=adk PE=3 SV=1 8 249 7.0E-29
sp|B4SA64|KAD_PELPB Adenylate kinase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=adk PE=3 SV=1 8 246 8.0E-29
sp|Q0C7Y1|KAD2_ASPTN Adenylate kinase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=adk1 PE=3 SV=1 8 256 9.0E-29
sp|B1JD29|KAD_PSEPW Adenylate kinase OS=Pseudomonas putida (strain W619) GN=adk PE=3 SV=1 8 248 9.0E-29
sp|B0KS64|KAD_PSEPG Adenylate kinase OS=Pseudomonas putida (strain GB-1) GN=adk PE=3 SV=1 8 248 9.0E-29
sp|A9IQ39|KAD_BORPD Adenylate kinase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=adk PE=3 SV=1 8 247 1.0E-28
sp|P33075|KAD2_SCHPO Adenylate kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=adk1 PE=1 SV=1 8 256 1.0E-28
sp|C3KEC6|KAD_PSEFS Adenylate kinase OS=Pseudomonas fluorescens (strain SBW25) GN=adk PE=3 SV=1 8 248 1.0E-28
sp|A4RD93|KAD2_MAGO7 Adenylate kinase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ADK1 PE=3 SV=1 8 256 1.0E-28
sp|P0DKX8|KAD_BORPE Adenylate kinase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=adk PE=3 SV=1 8 247 1.0E-28
sp|Q5B2V8|KAD2_EMENI Adenylate kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=adk1 PE=3 SV=1 8 256 1.0E-28
sp|P49981|KAD_NEIMU Adenylate kinase OS=Neisseria mucosa GN=adk PE=3 SV=1 8 248 1.0E-28
sp|Q3IKQ1|KAD_PSEHT Adenylate kinase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=adk PE=3 SV=1 8 246 2.0E-28
sp|Q1IDV1|KAD_PSEE4 Adenylate kinase OS=Pseudomonas entomophila (strain L48) GN=adk PE=3 SV=1 8 248 2.0E-28
sp|Q7VMY0|KAD_HAEDU Adenylate kinase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=adk PE=3 SV=1 8 250 2.0E-28
sp|A6RHI1|KAD2_AJECN Adenylate kinase OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=ADK1 PE=3 SV=1 6 256 2.0E-28
sp|B5XCA1|KAD2_SALSA Adenylate kinase 2, mitochondrial OS=Salmo salar GN=ak2 PE=2 SV=1 3 263 2.0E-28
sp|P24323|KAD_HAEIN Adenylate kinase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=adk PE=3 SV=2 8 246 2.0E-28
sp|A5UGF8|KAD_HAEIG Adenylate kinase OS=Haemophilus influenzae (strain PittGG) GN=adk PE=3 SV=1 8 246 2.0E-28
sp|Q4QNJ1|KAD_HAEI8 Adenylate kinase OS=Haemophilus influenzae (strain 86-028NP) GN=adk PE=3 SV=1 8 246 2.0E-28
sp|P0A137|KAD_PSEPU Adenylate kinase OS=Pseudomonas putida GN=adk PE=3 SV=1 8 248 3.0E-28
sp|P0A136|KAD_PSEPK Adenylate kinase OS=Pseudomonas putida (strain KT2440) GN=adk PE=3 SV=1 8 248 3.0E-28
sp|A5W880|KAD_PSEP1 Adenylate kinase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=adk PE=3 SV=1 8 248 3.0E-28
sp|A5UAD6|KAD_HAEIE Adenylate kinase OS=Haemophilus influenzae (strain PittEE) GN=adk PE=3 SV=1 8 246 3.0E-28
sp|B2W0K4|KAD2_PYRTR Adenylate kinase OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=adk1 PE=3 SV=2 6 256 3.0E-28
sp|Q9HE76|KAD2_NEUCR Adenylate kinase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=adk-1 PE=1 SV=2 8 256 3.0E-28
sp|B3QS41|KAD_CHLT3 Adenylate kinase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=adk PE=3 SV=1 8 267 4.0E-28
sp|Q2RFR8|KAD_MOOTA Adenylate kinase OS=Moorella thermoacetica (strain ATCC 39073) GN=adk PE=3 SV=1 8 257 4.0E-28
sp|B0D360|KAD2_LACBS Adenylate kinase OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=ADK1 PE=3 SV=1 8 260 5.0E-28
sp|Q1E4I8|KAD2_COCIM Adenylate kinase OS=Coccidioides immitis (strain RS) GN=ADK1 PE=3 SV=1 8 256 5.0E-28
sp|Q28F55|KAD2_XENTR Adenylate kinase 2, mitochondrial OS=Xenopus tropicalis GN=ak2 PE=2 SV=1 8 263 8.0E-28
sp|Q2UBH0|KAD2_ASPOR Adenylate kinase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=adk1 PE=3 SV=2 8 256 9.0E-28
sp|Q9FK35|KAD3_ARATH Adenylate kinase 3 OS=Arabidopsis thaliana GN=ADK2 PE=1 SV=1 146 255 1.0E-27
sp|B4S810|KAD_PROA2 Adenylate kinase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=adk PE=3 SV=1 8 246 1.0E-27
sp|Q6FD71|KAD_ACIAD Adenylate kinase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=adk PE=3 SV=1 8 246 1.0E-27
sp|Q12ZS7|KAD_METBU Adenylate kinase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=adk PE=3 SV=1 9 257 2.0E-27
sp|P08166|KAD2_BOVIN Adenylate kinase 2, mitochondrial OS=Bos taurus GN=AK2 PE=1 SV=2 5 257 2.0E-27
sp|A8M508|KAD_SALAI Adenylate kinase OS=Salinispora arenicola (strain CNS-205) GN=adk PE=3 SV=1 8 256 3.0E-27
sp|B3EJF7|KAD_CHLPB Adenylate kinase OS=Chlorobium phaeobacteroides (strain BS1) GN=adk PE=3 SV=1 8 246 4.0E-27
sp|Q54CT8|KADB_DICDI Probable adenylate kinase B OS=Dictyostelium discoideum GN=adkB PE=3 SV=1 145 262 4.0E-27
sp|P34346|KAD2_CAEEL Adenylate kinase OS=Caenorhabditis elegans GN=let-754 PE=3 SV=2 3 256 4.0E-27
sp|A4SLY1|KAD_AERS4 Adenylate kinase OS=Aeromonas salmonicida (strain A449) GN=adk PE=3 SV=1 8 269 4.0E-27
sp|Q1L8L9|KAD2_DANRE Adenylate kinase 2, mitochondrial OS=Danio rerio GN=ak2 PE=2 SV=1 3 263 6.0E-27
sp|A6LPT2|KAD_CLOB8 Adenylate kinase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=adk PE=3 SV=1 8 257 8.0E-27
sp|Q08480|KAD4_ORYSJ Adenylate kinase 4 OS=Oryza sativa subsp. japonica GN=ADK-B PE=2 SV=1 146 252 1.0E-26
sp|A0KL52|KAD_AERHH Adenylate kinase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=adk PE=3 SV=1 8 249 1.0E-26
sp|B8D813|KAD_BUCAT Adenylate kinase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=adk PE=3 SV=1 8 246 1.0E-26
sp|P57556|KAD_BUCAI Adenylate kinase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=adk PE=3 SV=1 8 246 1.0E-26
sp|B8D9R1|KAD_BUCA5 Adenylate kinase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=adk PE=3 SV=1 8 246 1.0E-26
sp|B0V9Q9|KAD_ACIBY Adenylate kinase OS=Acinetobacter baumannii (strain AYE) GN=adk PE=3 SV=1 8 246 1.0E-26
sp|A3M3G1|KAD_ACIBT Adenylate kinase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=adk PE=3 SV=2 8 246 1.0E-26
sp|B0VSA9|KAD_ACIBS Adenylate kinase OS=Acinetobacter baumannii (strain SDF) GN=adk PE=3 SV=1 8 246 1.0E-26
sp|B2HVT0|KAD_ACIBC Adenylate kinase OS=Acinetobacter baumannii (strain ACICU) GN=adk PE=3 SV=1 8 246 1.0E-26
sp|B7I8U4|KAD_ACIB5 Adenylate kinase OS=Acinetobacter baumannii (strain AB0057) GN=adk PE=3 SV=1 8 246 1.0E-26
sp|B7GXT4|KAD_ACIB3 Adenylate kinase OS=Acinetobacter baumannii (strain AB307-0294) GN=adk PE=3 SV=1 8 246 1.0E-26
sp|Q9WTP6|KAD2_MOUSE Adenylate kinase 2, mitochondrial OS=Mus musculus GN=Ak2 PE=1 SV=5 5 263 2.0E-26
sp|P49974|KAD_STRLI Adenylate kinase (Fragment) OS=Streptomyces lividans GN=adk PE=3 SV=1 8 252 2.0E-26
sp|A9BFZ7|KAD_PETMO Adenylate kinase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=adk PE=3 SV=1 8 268 2.0E-26
sp|Q18CH9|KAD_PEPD6 Adenylate kinase OS=Peptoclostridium difficile (strain 630) GN=adk PE=3 SV=1 8 271 2.0E-26
sp|P57837|KAD_PASMU Adenylate kinase OS=Pasteurella multocida (strain Pm70) GN=adk PE=3 SV=1 8 246 3.0E-26
sp|A1STI3|KAD_PSYIN Adenylate kinase OS=Psychromonas ingrahamii (strain 37) GN=adk PE=3 SV=1 8 267 3.0E-26
sp|Q09629|KADY_CAEEL Probable adenylate kinase isoenzyme ZK673.2 OS=Caenorhabditis elegans GN=ZK673.2 PE=3 SV=1 8 263 4.0E-26
sp|Q8K980|KAD_BUCAP Adenylate kinase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=adk PE=3 SV=1 8 273 5.0E-26
sp|P0CO42|KAD2_CRYNJ Adenylate kinase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ADK1 PE=3 SV=1 8 267 7.0E-26
sp|P0CO43|KAD2_CRYNB Adenylate kinase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ADK1 PE=3 SV=1 8 267 7.0E-26
sp|A4XBM5|KAD_SALTO Adenylate kinase OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=adk PE=3 SV=1 8 256 9.0E-26
sp|A8PR17|KAD2_MALGO Adenylate kinase OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=ADK1 PE=3 SV=1 5 260 1.0E-25
sp|P49979|KAD_NEIGO Adenylate kinase OS=Neisseria gonorrhoeae GN=adk PE=3 SV=1 8 248 1.0E-25
sp|B4RKA2|KAD_NEIG2 Adenylate kinase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=adk PE=3 SV=1 8 248 1.0E-25
sp|Q5F9J3|KAD_NEIG1 Adenylate kinase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=adk PE=3 SV=1 8 248 1.0E-25
sp|Q6LTE1|KAD_PHOPR Adenylate kinase OS=Photobacterium profundum GN=adk PE=1 SV=1 8 249 1.0E-25
sp|A9H3J9|KAD_GLUDA Adenylate kinase OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=adk PE=3 SV=1 9 268 1.0E-25
sp|B5FBZ5|KAD_VIBFM Adenylate kinase OS=Vibrio fischeri (strain MJ11) GN=adk PE=3 SV=1 8 249 1.0E-25
sp|Q5E6Q8|KAD_VIBF1 Adenylate kinase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=adk PE=3 SV=1 8 249 1.0E-25
sp|C4Z2V1|KAD_EUBE2 Adenylate kinase OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=adk PE=3 SV=1 8 257 2.0E-25
sp|B6EHK0|KAD_ALISL Adenylate kinase OS=Aliivibrio salmonicida (strain LFI1238) GN=adk PE=3 SV=1 8 249 2.0E-25
sp|P29410|KAD2_RAT Adenylate kinase 2, mitochondrial OS=Rattus norvegicus GN=Ak2 PE=2 SV=2 8 257 2.0E-25
sp|Q0AUK1|KAD_SYNWW Adenylate kinase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=adk PE=3 SV=1 9 257 2.0E-25
sp|Q47XA8|KAD_COLP3 Adenylate kinase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=adk PE=3 SV=1 8 262 2.0E-25
sp|A6VQC3|KAD_ACTSZ Adenylate kinase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=adk PE=3 SV=1 8 246 3.0E-25
sp|B0BQN2|KAD_ACTPJ Adenylate kinase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=adk PE=3 SV=1 8 246 3.0E-25
sp|A3N1U8|KAD_ACTP2 Adenylate kinase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=adk PE=3 SV=1 8 246 3.0E-25
sp|B4MQT3|KAD2_DROWI Adenylate kinase OS=Drosophila willistoni GN=Adk2 PE=3 SV=1 10 256 3.0E-25
sp|B3H271|KAD_ACTP7 Adenylate kinase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=adk PE=3 SV=1 8 246 4.0E-25
sp|B4KLY1|KAD2_DROMO Adenylate kinase OS=Drosophila mojavensis GN=Adk2 PE=3 SV=1 10 257 4.0E-25
sp|Q7N0P5|KAD_PHOLL Adenylate kinase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=adk PE=3 SV=1 8 249 4.0E-25
sp|Q59627|KAD_NEIPO Adenylate kinase (Fragment) OS=Neisseria polysaccharea GN=adk PE=3 SV=1 138 248 4.0E-25
sp|Q59628|KAD_NEIPH Adenylate kinase (Fragment) OS=Neisseria pharyngis GN=adk PE=3 SV=1 138 248 5.0E-25
sp|Q59615|KAD_NEILA Adenylate kinase (Fragment) OS=Neisseria lactamica GN=adk PE=3 SV=1 138 248 5.0E-25
sp|Q59594|KAD_NEICI Adenylate kinase (Fragment) OS=Neisseria cinerea GN=adk PE=3 SV=1 138 248 6.0E-25
sp|Q59596|KAD_NEIFL Adenylate kinase (Fragment) OS=Neisseria flavescens GN=adk PE=3 SV=1 138 248 6.0E-25
sp|B4J672|KAD2_DROGR Adenylate kinase OS=Drosophila grimshawi GN=Adk2 PE=3 SV=1 10 256 7.0E-25
sp|Q65UF7|KAD_MANSM Adenylate kinase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=adk PE=3 SV=1 8 246 7.0E-25
sp|B1KSK4|KAD_CLOBM Adenylate kinase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=adk PE=3 SV=1 8 263 9.0E-25
sp|B4QBH8|KAD2_DROSI Adenylate kinase OS=Drosophila simulans GN=Adk2 PE=3 SV=1 10 257 1.0E-24
sp|B4I2A8|KAD2_DROSE Adenylate kinase OS=Drosophila sechellia GN=Adk2-1 PE=3 SV=1 10 257 1.0E-24
sp|Q749A8|KAD_GEOSL Adenylate kinase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=adk PE=3 SV=1 9 258 1.0E-24
sp|B4PAR6|KAD2_DROYA Adenylate kinase OS=Drosophila yakuba GN=Adk2 PE=3 SV=1 10 257 1.0E-24
sp|Q3ACG0|KAD_CARHZ Adenylate kinase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=adk PE=3 SV=1 8 262 2.0E-24
sp|Q290A8|KAD2_DROPS Adenylate kinase OS=Drosophila pseudoobscura pseudoobscura GN=Adk2 PE=3 SV=2 10 257 3.0E-24
sp|Q9U915|KAD2_DROME Adenylate kinase OS=Drosophila melanogaster GN=Adk2 PE=1 SV=1 10 257 4.0E-24
sp|C3KVN0|KAD_CLOB6 Adenylate kinase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=adk PE=3 SV=1 8 263 4.0E-24
sp|B0X5E3|KAD2_CULQU Adenylate kinase OS=Culex quinquefasciatus GN=Adk2 PE=3 SV=1 10 260 4.0E-24
sp|Q7QJX9|KAD2_ANOGA Adenylate kinase OS=Anopheles gambiae GN=Adk2 PE=3 SV=2 10 260 4.0E-24
sp|Q839E3|KAD_ENTFA Adenylate kinase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=adk PE=3 SV=1 9 257 6.0E-24
sp|Q6CG57|KAD2_YARLI Adenylate kinase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ADK1 PE=3 SV=2 146 256 6.0E-24
sp|B1IGD3|KAD_CLOBK Adenylate kinase OS=Clostridium botulinum (strain Okra / Type B1) GN=adk PE=3 SV=1 8 260 9.0E-24
sp|Q46GB9|KAD_METBF Adenylate kinase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=adk PE=3 SV=1 9 263 9.0E-24
sp|B3MCQ5|KAD2_DROAN Adenylate kinase OS=Drosophila ananassae GN=Adk2 PE=3 SV=1 4 257 9.0E-24
sp|A7GJ53|KAD_CLOBL Adenylate kinase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=adk PE=3 SV=1 8 260 1.0E-23
sp|B5YHP1|KAD_THEYD Adenylate kinase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=adk PE=3 SV=1 8 263 1.0E-23
sp|B4LP08|KAD2_DROVI Adenylate kinase OS=Drosophila virilis GN=Adk2 PE=3 SV=1 10 257 2.0E-23
sp|Q890Q5|KAD_CLOTE Adenylate kinase OS=Clostridium tetani (strain Massachusetts / E88) GN=adk PE=3 SV=1 9 257 2.0E-23
sp|Q1LTX5|KAD_BAUCH Adenylate kinase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=adk PE=3 SV=1 141 251 2.0E-23
sp|Q54QJ9|KAD2_DICDI Adenylate kinase OS=Dictyostelium discoideum GN=adkA PE=3 SV=1 8 260 2.0E-23
sp|C1FMT0|KAD_CLOBJ Adenylate kinase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=adk PE=3 SV=1 8 260 2.0E-23
sp|A5I7I5|KAD_CLOBH Adenylate kinase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=adk PE=3 SV=1 8 260 2.0E-23
sp|A7FZ52|KAD_CLOB1 Adenylate kinase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=adk PE=3 SV=1 8 260 2.0E-23
sp|Q59591|KAD_NEIAN Adenylate kinase (Fragment) OS=Neisseria animalis GN=adk PE=3 SV=1 138 248 3.0E-23
sp|B1I3R5|KAD_DESAP Adenylate kinase OS=Desulforudis audaxviator (strain MP104C) GN=adk PE=3 SV=1 9 257 3.0E-23
sp|B1YVE0|KAD_BURA4 Adenylate kinase OS=Burkholderia ambifaria (strain MC40-6) GN=adk PE=3 SV=1 141 247 3.0E-23
sp|Q0BCH1|KAD_BURCM Adenylate kinase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=adk PE=3 SV=1 141 247 4.0E-23
sp|Q0BMG1|KAD_FRATO Adenylate kinase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=adk PE=3 SV=1 8 246 4.0E-23
sp|Q2A425|KAD_FRATH Adenylate kinase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=adk PE=3 SV=1 8 246 4.0E-23
sp|Q8CRI0|KAD_STAES Adenylate kinase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=adk PE=3 SV=1 8 257 4.0E-23
sp|Q5HM20|KAD_STAEQ Adenylate kinase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=adk PE=3 SV=1 8 257 4.0E-23
sp|A8XZJ0|KAD2_CAEBR Adenylate kinase OS=Caenorhabditis briggsae GN=let-754 PE=3 SV=2 146 257 4.0E-23
sp|B2TIJ6|KAD_CLOBB Adenylate kinase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=adk PE=3 SV=1 8 257 4.0E-23
sp|B3NQ53|KAD2_DROER Adenylate kinase OS=Drosophila erecta GN=Adk2 PE=3 SV=1 10 257 6.0E-23
sp|B2UYD1|KAD_CLOBA Adenylate kinase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=adk PE=3 SV=1 8 257 7.0E-23
sp|Q63WL6|KAD_BURPS Adenylate kinase OS=Burkholderia pseudomallei (strain K96243) GN=adk PE=3 SV=1 141 250 8.0E-23
sp|A3N6K4|KAD_BURP6 Adenylate kinase OS=Burkholderia pseudomallei (strain 668) GN=adk PE=3 SV=1 141 250 8.0E-23
sp|Q3JVB1|KAD_BURP1 Adenylate kinase OS=Burkholderia pseudomallei (strain 1710b) GN=adk PE=1 SV=1 141 250 8.0E-23
sp|A3NS87|KAD_BURP0 Adenylate kinase OS=Burkholderia pseudomallei (strain 1106a) GN=adk PE=3 SV=1 141 250 8.0E-23
sp|A1V117|KAD_BURMS Adenylate kinase OS=Burkholderia mallei (strain SAVP1) GN=adk PE=3 SV=1 141 250 8.0E-23
sp|Q62HI0|KAD_BURMA Adenylate kinase OS=Burkholderia mallei (strain ATCC 23344) GN=adk PE=3 SV=1 141 250 8.0E-23
sp|A2S516|KAD_BURM9 Adenylate kinase OS=Burkholderia mallei (strain NCTC 10229) GN=adk PE=3 SV=1 141 250 8.0E-23
sp|A3MN48|KAD_BURM7 Adenylate kinase OS=Burkholderia mallei (strain NCTC 10247) GN=adk PE=3 SV=1 141 250 8.0E-23
sp|Q1HQK0|KAD2_AEDAE Adenylate kinase OS=Aedes aegypti GN=Adk2 PE=2 SV=1 10 260 9.0E-23
sp|A7NBG3|KAD_FRATF Adenylate kinase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=adk PE=3 SV=1 8 246 9.0E-23
sp|A9AGK1|KAD_BURM1 Adenylate kinase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=adk PE=3 SV=1 141 247 9.0E-23
sp|A4IYJ6|KAD_FRATW Adenylate kinase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=adk PE=3 SV=1 8 246 9.0E-23
sp|Q5NFR4|KAD_FRATT Adenylate kinase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=adk PE=1 SV=1 8 246 9.0E-23
sp|A0Q713|KAD_FRATN Adenylate kinase OS=Francisella tularensis subsp. novicida (strain U112) GN=adk PE=3 SV=1 8 246 9.0E-23
sp|B2SGC2|KAD_FRATM Adenylate kinase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=adk PE=3 SV=1 8 246 9.0E-23
sp|Q14H66|KAD_FRAT1 Adenylate kinase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=adk PE=3 SV=1 8 246 9.0E-23
sp|P07170|KAD2_YEAST Adenylate kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADK1 PE=1 SV=2 146 256 1.0E-22
sp|B3LG61|KAD2_YEAS1 Adenylate kinase OS=Saccharomyces cerevisiae (strain RM11-1a) GN=ADK1 PE=3 SV=1 146 256 1.0E-22
sp|A6ZYI0|KAD2_YEAS7 Adenylate kinase OS=Saccharomyces cerevisiae (strain YJM789) GN=ADK1 PE=3 SV=1 146 256 1.0E-22
sp|A4JH80|KAD_BURVG Adenylate kinase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=adk PE=3 SV=1 141 247 1.0E-22
sp|A7Z0Q9|KAD_BACMF Adenylate kinase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=adk PE=3 SV=1 9 257 1.0E-22
sp|Q71WG7|KAD_LISMF Adenylate kinase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=adk PE=3 SV=1 138 257 1.0E-22
sp|C1KZF9|KAD_LISMC Adenylate kinase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=adk PE=3 SV=1 138 257 1.0E-22
sp|Q927M8|KAD_LISIN Adenylate kinase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=adk PE=3 SV=1 138 257 2.0E-22
sp|Q2T0K4|KAD_BURTA Adenylate kinase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=adk PE=3 SV=1 141 260 2.0E-22
sp|Q493A3|KAD_BLOPB Adenylate kinase OS=Blochmannia pennsylvanicus (strain BPEN) GN=adk PE=3 SV=1 140 271 2.0E-22
sp|Q39DJ3|KAD_BURL3 Adenylate kinase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=adk PE=3 SV=1 141 247 2.0E-22
sp|P38372|KAD_BACHD Adenylate kinase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=adk PE=3 SV=2 9 257 3.0E-22
sp|B4E9G1|KAD_BURCJ Adenylate kinase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=adk PE=3 SV=1 141 247 3.0E-22
sp|A0K9X1|KAD_BURCH Adenylate kinase OS=Burkholderia cenocepacia (strain HI2424) GN=adk PE=3 SV=1 141 247 3.0E-22
sp|B1JXF8|KAD_BURCC Adenylate kinase OS=Burkholderia cenocepacia (strain MC0-3) GN=adk PE=3 SV=1 141 247 3.0E-22
sp|Q1BU66|KAD_BURCA Adenylate kinase OS=Burkholderia cenocepacia (strain AU 1054) GN=adk PE=3 SV=1 141 247 3.0E-22
sp|C4KZM5|KAD_EXISA Adenylate kinase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=adk PE=3 SV=1 138 257 3.0E-22
sp|Q8R7X4|KAD_CALS4 Adenylate kinase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=adk PE=3 SV=1 8 263 3.0E-22
sp|A5CXT4|KAD_VESOH Adenylate kinase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=adk PE=3 SV=1 141 246 3.0E-22
sp|Q5REI7|KAD2_PONAB Adenylate kinase 2, mitochondrial OS=Pongo abelii GN=AK2 PE=2 SV=3 146 257 4.0E-22
sp|P54819|KAD2_HUMAN Adenylate kinase 2, mitochondrial OS=Homo sapiens GN=AK2 PE=1 SV=2 146 257 4.0E-22
sp|P65202|KAD_STAAW Adenylate kinase OS=Staphylococcus aureus (strain MW2) GN=adk PE=3 SV=1 9 257 4.0E-22
sp|Q6G792|KAD_STAAS Adenylate kinase OS=Staphylococcus aureus (strain MSSA476) GN=adk PE=3 SV=1 9 257 4.0E-22
sp|Q6GEK4|KAD_STAAR Adenylate kinase OS=Staphylococcus aureus (strain MRSA252) GN=adk PE=3 SV=1 9 257 4.0E-22
sp|P99062|KAD_STAAN Adenylate kinase OS=Staphylococcus aureus (strain N315) GN=adk PE=1 SV=1 9 257 4.0E-22
sp|P65201|KAD_STAAM Adenylate kinase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=adk PE=3 SV=1 9 257 4.0E-22
sp|Q5HDX9|KAD_STAAC Adenylate kinase OS=Staphylococcus aureus (strain COL) GN=adk PE=3 SV=1 9 257 4.0E-22
sp|Q8PV26|KAD_METMA Adenylate kinase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=adk PE=3 SV=1 8 257 5.0E-22
sp|Q6FM32|KAD2_CANGA Adenylate kinase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ADK1 PE=3 SV=1 146 256 5.0E-22
sp|B0UT69|KAD_HISS2 Adenylate kinase OS=Histophilus somni (strain 2336) GN=adk PE=3 SV=1 8 246 6.0E-22
sp|Q0I2Y5|KAD_HAES1 Adenylate kinase OS=Haemophilus somnus (strain 129Pt) GN=adk PE=3 SV=1 8 246 6.0E-22
sp|P61115|KAD_BDEBA Adenylate kinase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=adk PE=3 SV=1 145 272 6.0E-22
sp|Q8TRS3|KAD_METAC Adenylate kinase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=adk PE=3 SV=1 8 276 6.0E-22
sp|Q8Y449|KAD_LISMO Adenylate kinase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=adk PE=3 SV=1 138 257 6.0E-22
sp|B7IHW7|KAD_THEAB Adenylate kinase OS=Thermosipho africanus (strain TCF52B) GN=adk PE=3 SV=1 9 257 8.0E-22
sp|Q8XHU4|KAD_CLOPE Adenylate kinase OS=Clostridium perfringens (strain 13 / Type A) GN=adk PE=3 SV=1 7 257 8.0E-22
sp|Q0SQG5|KAD_CLOPS Adenylate kinase OS=Clostridium perfringens (strain SM101 / Type A) GN=adk PE=3 SV=1 8 257 1.0E-21
sp|Q0TMR7|KAD_CLOP1 Adenylate kinase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=adk PE=3 SV=1 8 257 1.0E-21
sp|B8I800|KAD_CLOCE Adenylate kinase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=adk PE=3 SV=1 8 269 1.0E-21
sp|Q3B4C0|KAD_CHLL7 Adenylate kinase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=adk PE=3 SV=1 141 249 1.0E-21
sp|A4XLR0|KAD_CALS8 Adenylate kinase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=adk PE=3 SV=1 8 264 1.0E-21
sp|A5N4R8|KAD_CLOK5 Adenylate kinase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=adk PE=3 SV=1 8 269 2.0E-21
sp|B9DYD0|KAD_CLOK1 Adenylate kinase OS=Clostridium kluyveri (strain NBRC 12016) GN=adk PE=3 SV=1 8 269 2.0E-21
sp|Q9ZUU1|KAD1_ARATH Adenylate kinase 1, chloroplastic OS=Arabidopsis thaliana GN=ADK PE=1 SV=1 5 256 2.0E-21
sp|C0ZIK1|KAD_BREBN Adenylate kinase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=adk PE=3 SV=1 9 257 2.0E-21
sp|A4SEQ7|KAD_CHLPM Adenylate kinase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=adk PE=3 SV=1 140 247 2.0E-21
sp|B3E851|KAD_GEOLS Adenylate kinase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=adk PE=3 SV=1 9 260 2.0E-21
sp|A1AVD5|KAD_RUTMC Adenylate kinase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=adk PE=3 SV=1 139 246 2.0E-21
sp|Q8KD69|KAD_CHLTE Adenylate kinase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=adk PE=3 SV=1 138 246 2.0E-21
sp|Q3A6M6|KAD_PELCD Adenylate kinase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=adk PE=3 SV=1 8 258 3.0E-21
sp|B0TXR2|KAD_FRAP2 Adenylate kinase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=adk PE=3 SV=1 138 246 3.0E-21
sp|C4ZBT9|KAD_EUBR3 Adenylate kinase OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=adk PE=3 SV=1 8 257 3.0E-21
sp|A0ALU7|KAD_LISW6 Adenylate kinase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=adk PE=3 SV=1 138 257 4.0E-21
sp|A6LLN4|KAD_THEM4 Adenylate kinase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=adk PE=3 SV=1 9 257 4.0E-21
sp|Q0W1W4|KAD_METAR Adenylate kinase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=adk PE=3 SV=1 8 257 4.0E-21
sp|Q5JH68|KAD_THEKO Adenylate kinase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=adk PE=3 SV=1 145 257 5.0E-21
sp|A0B9A2|KAD_METTP Adenylate kinase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=adk PE=3 SV=1 9 272 6.0E-21
sp|B8DB29|KAD_LISMH Adenylate kinase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=adk PE=3 SV=1 138 257 6.0E-21
sp|Q3IMW0|KAD_NATPD Adenylate kinase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=adk1 PE=3 SV=1 8 267 7.0E-21
sp|C5A5D0|KAD_THEGJ Adenylate kinase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=adk PE=3 SV=1 145 257 1.0E-20
sp|B2G8V7|KAD_LACRJ Adenylate kinase OS=Lactobacillus reuteri (strain JCM 1112) GN=adk PE=3 SV=1 8 257 1.0E-20
sp|B7L0S9|KAD_METC4 Adenylate kinase OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=adk PE=3 SV=1 8 258 1.0E-20
sp|A9W4R9|KAD_METEP Adenylate kinase OS=Methylobacterium extorquens (strain PA1) GN=adk PE=3 SV=1 8 258 1.0E-20
sp|B8IT32|KAD_METNO Adenylate kinase OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=adk PE=3 SV=1 8 264 1.0E-20
sp|A5V5Y1|KAD_SPHWW Adenylate kinase OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=adk PE=3 SV=1 9 258 2.0E-20
sp|C5BRP4|KAD_TERTT Adenylate kinase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=adk PE=3 SV=1 141 249 2.0E-20
sp|Q7VRB6|KAD_BLOFL Adenylate kinase OS=Blochmannia floridanus GN=adk PE=3 SV=1 130 249 2.0E-20
sp|Q9UZN1|KAD_PYRAB Adenylate kinase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=adk PE=3 SV=1 145 267 2.0E-20
sp|C0M6X3|KAD_STRE4 Adenylate kinase OS=Streptococcus equi subsp. equi (strain 4047) GN=adk PE=3 SV=1 9 257 2.0E-20
sp|C0ME26|KAD_STRS7 Adenylate kinase OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=adk PE=3 SV=1 9 257 2.0E-20
sp|Q38UT2|KAD_LACSS Adenylate kinase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=adk PE=3 SV=1 8 257 2.0E-20
sp|Q5NQ43|KAD_ZYMMO Adenylate kinase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=adk PE=3 SV=1 9 258 3.0E-20
sp|B6YVU5|KAD_THEON Adenylate kinase OS=Thermococcus onnurineus (strain NA1) GN=adk PE=3 SV=1 145 257 3.0E-20
sp|B9MKG1|KAD_CALBD Adenylate kinase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=adk PE=3 SV=1 8 253 3.0E-20
sp|O58844|KAD_PYRHO Adenylate kinase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=adk PE=3 SV=1 145 257 4.0E-20
sp|Q2G8V9|KAD_NOVAD Adenylate kinase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=adk PE=3 SV=1 9 267 4.0E-20
sp|Q8EUD3|KAD_MYCPE Adenylate kinase OS=Mycoplasma penetrans (strain HF-2) GN=adk PE=3 SV=1 143 275 4.0E-20
sp|Q9HPA7|KAD_HALSA Adenylate kinase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=adk PE=2 SV=1 141 263 5.0E-20
sp|B0R683|KAD_HALS3 Adenylate kinase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=adk PE=3 SV=1 141 263 5.0E-20
sp|Q3J7A3|KAD_NITOC Adenylate kinase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=adk PE=3 SV=1 8 264 6.0E-20
sp|A1ALW2|KAD_PELPD Adenylate kinase OS=Pelobacter propionicus (strain DSM 2379) GN=adk PE=3 SV=1 9 257 7.0E-20
sp|Q8U207|KAD_PYRFU Adenylate kinase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=adk PE=3 SV=1 145 257 7.0E-20
sp|Q7NKT5|KAD_GLOVI Adenylate kinase OS=Gloeobacter violaceus (strain PCC 7421) GN=adk PE=3 SV=1 8 271 8.0E-20
sp|C5CGI1|KAD_KOSOT Adenylate kinase OS=Kosmotoga olearia (strain TBF 19.5.1) GN=adk PE=3 SV=1 9 272 9.0E-20
sp|Q8HSW1|KAD1_SOLTU Adenylate kinase OS=Solanum tuberosum GN=ADK PE=2 SV=1 5 256 9.0E-20
sp|A5FZU4|KAD_ACICJ Adenylate kinase OS=Acidiphilium cryptum (strain JF-5) GN=adk PE=3 SV=1 9 277 1.0E-19
sp|Q5WLP1|KAD_BACSK Adenylate kinase OS=Bacillus clausii (strain KSM-K16) GN=adk PE=3 SV=1 138 257 1.0E-19
sp|A9NEF4|KAD_ACHLI Adenylate kinase OS=Acholeplasma laidlawii (strain PG-8A) GN=adk PE=3 SV=1 7 257 1.0E-19
sp|A4J592|KAD_DESRM Adenylate kinase OS=Desulfotomaculum reducens (strain MI-1) GN=adk PE=3 SV=1 8 267 1.0E-19
sp|Q2N9D3|KAD_ERYLH Adenylate kinase OS=Erythrobacter litoralis (strain HTCC2594) GN=adk PE=3 SV=1 9 267 1.0E-19
sp|B1Z772|KAD_METPB Adenylate kinase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=adk PE=3 SV=1 8 264 2.0E-19
sp|B1GZA3|KAD_UNCTG Adenylate kinase OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=adk PE=3 SV=1 10 261 2.0E-19
sp|A7HM31|KAD_FERNB Adenylate kinase OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=adk PE=3 SV=1 139 262 2.0E-19
sp|A3DJJ3|KAD_CLOTH Adenylate kinase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=adk PE=3 SV=1 141 257 2.0E-19
sp|Q97EJ9|KAD_CLOAB Adenylate kinase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=adk PE=3 SV=1 138 257 3.0E-19
sp|B9K8A7|KAD_THENN Adenylate kinase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=adk PE=3 SV=1 138 257 3.0E-19
sp|Q8GGL2|KAD_THENE Adenylate kinase OS=Thermotoga neapolitana GN=adk PE=3 SV=1 138 257 3.0E-19
sp|Q057D8|KAD_BUCCC Adenylate kinase OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=adk PE=3 SV=1 146 242 4.0E-19
sp|Q9X1I8|KAD_THEMA Adenylate kinase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=adk PE=3 SV=1 138 257 4.0E-19
sp|B3ED51|KAD_CHLL2 Adenylate kinase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=adk PE=3 SV=1 141 247 5.0E-19
sp|B2S3I6|KAD_TREPS Adenylate kinase OS=Treponema pallidum subsp. pallidum (strain SS14) GN=adk PE=3 SV=1 138 276 6.0E-19
sp|O83604|KAD_TREPA Adenylate kinase OS=Treponema pallidum (strain Nichols) GN=adk PE=3 SV=1 138 276 6.0E-19
sp|B1LBL9|KAD_THESQ Adenylate kinase OS=Thermotoga sp. (strain RQ2) GN=adk PE=3 SV=1 138 257 6.0E-19
sp|A5IMA4|KAD_THEP1 Adenylate kinase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=adk PE=3 SV=1 138 257 6.0E-19
sp|B1YGX1|KAD_EXIS2 Adenylate kinase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=adk PE=3 SV=1 9 257 9.0E-19
sp|C5D3T8|KAD_GEOSW Adenylate kinase OS=Geobacillus sp. (strain WCH70) GN=adk PE=3 SV=1 9 257 9.0E-19
sp|A8F9A6|KAD_BACP2 Adenylate kinase OS=Bacillus pumilus (strain SAFR-032) GN=adk PE=3 SV=1 138 257 9.0E-19
sp|C6A2Q1|KAD_THESM Adenylate kinase OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=adk PE=3 SV=1 145 257 1.0E-18
sp|Q83E75|KAD_COXBU Adenylate kinase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=adk PE=3 SV=1 141 248 1.0E-18
sp|A9NBU5|KAD_COXBR Adenylate kinase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=adk PE=3 SV=1 141 248 1.0E-18
sp|A9KED8|KAD_COXBN Adenylate kinase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=adk PE=3 SV=1 141 248 1.0E-18
sp|B6J1M3|KAD_COXB2 Adenylate kinase OS=Coxiella burnetii (strain CbuG_Q212) GN=adk PE=3 SV=1 141 248 1.0E-18
sp|B6J8H9|KAD_COXB1 Adenylate kinase OS=Coxiella burnetii (strain CbuK_Q154) GN=adk PE=3 SV=1 141 248 1.0E-18
sp|Q02W46|KAD_LACLS Adenylate kinase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=adk PE=3 SV=1 138 257 2.0E-18
sp|A2RNN2|KAD_LACLM Adenylate kinase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=adk PE=3 SV=1 138 257 2.0E-18
sp|P27143|KAD_LACLC Adenylate kinase OS=Lactococcus lactis subsp. cremoris GN=adk PE=3 SV=3 138 257 2.0E-18
sp|B0RZT0|KAD_FINM2 Adenylate kinase OS=Finegoldia magna (strain ATCC 29328) GN=adk PE=3 SV=1 8 272 3.0E-18
sp|B0K5R3|KAD_THEPX Adenylate kinase OS=Thermoanaerobacter sp. (strain X514) GN=adk PE=3 SV=1 8 262 3.0E-18
sp|B0KCM0|KAD_THEP3 Adenylate kinase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=adk PE=3 SV=1 8 262 3.0E-18
sp|B0TC77|KAD_HELMI Adenylate kinase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=adk PE=3 SV=1 9 257 3.0E-18
sp|B4UBC0|KAD_ANASK Adenylate kinase OS=Anaeromyxobacter sp. (strain K) GN=adk PE=3 SV=1 9 262 3.0E-18
sp|B9M6F7|KAD_GEODF Adenylate kinase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=adk PE=3 SV=1 9 267 3.0E-18
sp|B8J881|KAD_ANAD2 Adenylate kinase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=adk PE=3 SV=1 9 262 3.0E-18
sp|P58117|KAD_LACLA Adenylate kinase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=adk PE=3 SV=1 138 257 4.0E-18
sp|P43414|KAD_STRCO Adenylate kinase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=adk PE=3 SV=3 8 252 4.0E-18
sp|Q2IJ70|KAD_ANADE Adenylate kinase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=adk PE=3 SV=1 141 262 5.0E-18
sp|A9KJH3|KAD_CLOPH Adenylate kinase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=adk PE=3 SV=1 8 257 6.0E-18
sp|P16304|KAD_BACSU Adenylate kinase OS=Bacillus subtilis (strain 168) GN=adk PE=1 SV=2 138 257 6.0E-18
sp|Q9PKR0|KAD_CHLMU Adenylate kinase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=adk PE=3 SV=1 9 257 8.0E-18
sp|C6E4N6|KAD_GEOSM Adenylate kinase OS=Geobacter sp. (strain M21) GN=adk PE=3 SV=1 9 262 8.0E-18
sp|B1HMV9|KAD_LYSSC Adenylate kinase OS=Lysinibacillus sphaericus (strain C3-41) GN=adk PE=3 SV=1 8 257 8.0E-18
sp|B3WAJ7|KAD_LACCB Adenylate kinase OS=Lactobacillus casei (strain BL23) GN=adk PE=3 SV=1 138 276 2.0E-17
sp|B9JDU9|KAD_AGRRK Adenylate kinase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=adk PE=3 SV=1 8 262 2.0E-17
sp|A0LIL1|KAD_SYNFM Adenylate kinase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=adk PE=3 SV=1 141 260 2.0E-17
sp|Q10S93|KAD1_ORYSJ Probable adenylate kinase 1, chloroplastic OS=Oryza sativa subsp. japonica GN=Os03g0130400 PE=2 SV=1 5 256 2.0E-17
sp|Q67JW4|KAD_SYMTH Adenylate kinase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=adk PE=3 SV=1 9 257 2.0E-17
sp|A8F4T2|KAD_PSELT Adenylate kinase OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=adk PE=3 SV=1 141 256 2.0E-17
sp|B5EFS1|KAD_GEOBB Adenylate kinase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=adk PE=3 SV=1 9 262 2.0E-17
sp|Q8ETW3|KAD_OCEIH Adenylate kinase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=adk PE=3 SV=1 138 257 4.0E-17
sp|Q5UXG8|KAD_HALMA Adenylate kinase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=adk PE=3 SV=1 146 267 6.0E-17
sp|A7HBN9|KAD_ANADF Adenylate kinase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=adk PE=3 SV=1 9 262 7.0E-17
sp|A0L8G8|KAD_MAGMM Adenylate kinase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=adk PE=3 SV=1 8 258 7.0E-17
sp|P35140|KAD_BACLD Adenylate kinase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=adk PE=3 SV=2 9 257 7.0E-17
sp|P84139|KAD_SPOGL Adenylate kinase OS=Sporosarcina globispora GN=adk PE=1 SV=1 9 257 7.0E-17
sp|Q8RE31|KAD_FUSNN Adenylate kinase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=adk PE=3 SV=1 138 269 7.0E-17
sp|O29581|KAD_ARCFU Adenylate kinase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=adk PE=3 SV=1 141 257 9.0E-17
sp|Q82DM5|KAD_STRAW Adenylate kinase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=adk PE=3 SV=1 8 258 2.0E-16
sp|Q4FLN8|KAD_PELUB Adenylate kinase OS=Pelagibacter ubique (strain HTCC1062) GN=adk PE=3 SV=1 9 267 2.0E-16
sp|P27142|KAD_GEOSE Adenylate kinase OS=Geobacillus stearothermophilus GN=adk PE=1 SV=1 9 257 2.0E-16
sp|O51378|KAD_BORBU Adenylate kinase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=adk PE=3 SV=1 9 256 3.0E-16
sp|Q9PQP0|KAD_UREPA Adenylate kinase OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=adk PE=3 SV=1 8 246 3.0E-16
sp|B1AIP0|KAD_UREP2 Adenylate kinase OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=adk PE=3 SV=1 8 246 3.0E-16
sp|A0LRP1|KAD_ACIC1 Adenylate kinase OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=adk PE=3 SV=1 138 258 5.0E-16
sp|Q1GPC0|KAD_SPHAL Adenylate kinase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=adk PE=3 SV=1 9 258 6.0E-16
sp|Q2W2L1|KAD_MAGSA Adenylate kinase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=adk PE=3 SV=1 141 257 6.0E-16
sp|Q6CG57|KAD2_YARLI Adenylate kinase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ADK1 PE=3 SV=2 5 79 9.0E-16
sp|Q6FM32|KAD2_CANGA Adenylate kinase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ADK1 PE=3 SV=1 8 79 3.0E-14
sp|A1AVD5|KAD_RUTMC Adenylate kinase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=adk PE=3 SV=1 9 91 3.0E-14
sp|A5CXT4|KAD_VESOH Adenylate kinase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=adk PE=3 SV=1 9 95 7.0E-14
sp|A4SEQ7|KAD_CHLPM Adenylate kinase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=adk PE=3 SV=1 8 91 7.0E-14
sp|Q8KD69|KAD_CHLTE Adenylate kinase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=adk PE=3 SV=1 8 91 9.0E-14
sp|P07170|KAD2_YEAST Adenylate kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADK1 PE=1 SV=2 1 79 1.0E-13
sp|B3LG61|KAD2_YEAS1 Adenylate kinase OS=Saccharomyces cerevisiae (strain RM11-1a) GN=ADK1 PE=3 SV=1 1 79 1.0E-13
sp|A6ZYI0|KAD2_YEAS7 Adenylate kinase OS=Saccharomyces cerevisiae (strain YJM789) GN=ADK1 PE=3 SV=1 1 79 1.0E-13
sp|C5BRP4|KAD_TERTT Adenylate kinase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=adk PE=3 SV=1 8 91 1.0E-13
sp|Q83E75|KAD_COXBU Adenylate kinase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=adk PE=3 SV=1 8 91 5.0E-13
sp|A9NBU5|KAD_COXBR Adenylate kinase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=adk PE=3 SV=1 8 91 5.0E-13
sp|A9KED8|KAD_COXBN Adenylate kinase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=adk PE=3 SV=1 8 91 5.0E-13
sp|B6J1M3|KAD_COXB2 Adenylate kinase OS=Coxiella burnetii (strain CbuG_Q212) GN=adk PE=3 SV=1 8 91 5.0E-13
sp|B6J8H9|KAD_COXB1 Adenylate kinase OS=Coxiella burnetii (strain CbuK_Q154) GN=adk PE=3 SV=1 8 91 5.0E-13
sp|B3ED51|KAD_CHLL2 Adenylate kinase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=adk PE=3 SV=1 8 91 1.0E-12
sp|Q3B4C0|KAD_CHLL7 Adenylate kinase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=adk PE=3 SV=1 8 91 4.0E-12
sp|Q63WL6|KAD_BURPS Adenylate kinase OS=Burkholderia pseudomallei (strain K96243) GN=adk PE=3 SV=1 8 91 5.0E-12
sp|A3N6K4|KAD_BURP6 Adenylate kinase OS=Burkholderia pseudomallei (strain 668) GN=adk PE=3 SV=1 8 91 5.0E-12
sp|Q3JVB1|KAD_BURP1 Adenylate kinase OS=Burkholderia pseudomallei (strain 1710b) GN=adk PE=1 SV=1 8 91 5.0E-12
sp|A3NS87|KAD_BURP0 Adenylate kinase OS=Burkholderia pseudomallei (strain 1106a) GN=adk PE=3 SV=1 8 91 5.0E-12
sp|A1V117|KAD_BURMS Adenylate kinase OS=Burkholderia mallei (strain SAVP1) GN=adk PE=3 SV=1 8 91 5.0E-12
sp|Q62HI0|KAD_BURMA Adenylate kinase OS=Burkholderia mallei (strain ATCC 23344) GN=adk PE=3 SV=1 8 91 5.0E-12
sp|A2S516|KAD_BURM9 Adenylate kinase OS=Burkholderia mallei (strain NCTC 10229) GN=adk PE=3 SV=1 8 91 5.0E-12
sp|A3MN48|KAD_BURM7 Adenylate kinase OS=Burkholderia mallei (strain NCTC 10247) GN=adk PE=3 SV=1 8 91 5.0E-12
sp|Q2T0K4|KAD_BURTA Adenylate kinase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=adk PE=3 SV=1 8 91 6.0E-12
sp|A9AGK1|KAD_BURM1 Adenylate kinase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=adk PE=3 SV=1 8 91 1.0E-11
sp|Q39DJ3|KAD_BURL3 Adenylate kinase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=adk PE=3 SV=1 8 91 1.0E-11
sp|B4E9G1|KAD_BURCJ Adenylate kinase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=adk PE=3 SV=1 8 91 1.0E-11
sp|A0K9X1|KAD_BURCH Adenylate kinase OS=Burkholderia cenocepacia (strain HI2424) GN=adk PE=3 SV=1 8 91 1.0E-11
sp|B1JXF8|KAD_BURCC Adenylate kinase OS=Burkholderia cenocepacia (strain MC0-3) GN=adk PE=3 SV=1 8 91 1.0E-11
sp|Q1BU66|KAD_BURCA Adenylate kinase OS=Burkholderia cenocepacia (strain AU 1054) GN=adk PE=3 SV=1 8 91 1.0E-11
sp|Q9UZN1|KAD_PYRAB Adenylate kinase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=adk PE=3 SV=1 9 81 2.0E-11
sp|A4JH80|KAD_BURVG Adenylate kinase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=adk PE=3 SV=1 8 91 4.0E-11
sp|B1YVE0|KAD_BURA4 Adenylate kinase OS=Burkholderia ambifaria (strain MC40-6) GN=adk PE=3 SV=1 8 91 5.0E-11
sp|Q0BCH1|KAD_BURCM Adenylate kinase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=adk PE=3 SV=1 8 91 5.0E-11
sp|Q9FK35|KAD3_ARATH Adenylate kinase 3 OS=Arabidopsis thaliana GN=ADK2 PE=1 SV=1 8 95 2.0E-10
sp|Q08480|KAD4_ORYSJ Adenylate kinase 4 OS=Oryza sativa subsp. japonica GN=ADK-B PE=2 SV=1 8 91 2.0E-10
sp|Q5R421|KAD4_PONAB Adenylate kinase 4, mitochondrial OS=Pongo abelii GN=AK4 PE=2 SV=1 8 91 3.0E-10
sp|O58844|KAD_PYRHO Adenylate kinase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=adk PE=3 SV=1 9 81 3.0E-10
sp|A0LIL1|KAD_SYNFM Adenylate kinase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=adk PE=3 SV=1 9 91 3.0E-10
sp|P27144|KAD4_HUMAN Adenylate kinase 4, mitochondrial OS=Homo sapiens GN=AK4 PE=1 SV=1 8 91 4.0E-10
sp|A0LRP1|KAD_ACIC1 Adenylate kinase OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=adk PE=3 SV=1 8 79 1.0E-09
sp|P61115|KAD_BDEBA Adenylate kinase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=adk PE=3 SV=1 9 81 4.0E-09
sp|B0TXR2|KAD_FRAP2 Adenylate kinase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=adk PE=3 SV=1 8 99 6.0E-09
sp|Q1LTX5|KAD_BAUCH Adenylate kinase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=adk PE=3 SV=1 8 95 2.0E-08
sp|P16304|KAD_BACSU Adenylate kinase OS=Bacillus subtilis (strain 168) GN=adk PE=1 SV=2 9 91 2.0E-08
sp|A8XZJ0|KAD2_CAEBR Adenylate kinase OS=Caenorhabditis briggsae GN=let-754 PE=3 SV=2 3 100 3.0E-08
sp|Q5REI7|KAD2_PONAB Adenylate kinase 2, mitochondrial OS=Pongo abelii GN=AK2 PE=2 SV=3 5 91 4.0E-08
sp|P54819|KAD2_HUMAN Adenylate kinase 2, mitochondrial OS=Homo sapiens GN=AK2 PE=1 SV=2 5 91 4.0E-08
sp|Q54CT8|KADB_DICDI Probable adenylate kinase B OS=Dictyostelium discoideum GN=adkB PE=3 SV=1 8 86 6.0E-08
sp|Q8U207|KAD_PYRFU Adenylate kinase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=adk PE=3 SV=1 9 81 6.0E-08
sp|A8F4T2|KAD_PSELT Adenylate kinase OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=adk PE=3 SV=1 8 86 7.0E-08
sp|Q8RE31|KAD_FUSNN Adenylate kinase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=adk PE=3 SV=1 9 84 7.0E-08
sp|O29581|KAD_ARCFU Adenylate kinase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=adk PE=3 SV=1 9 81 9.0E-08
sp|C4KZM5|KAD_EXISA Adenylate kinase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=adk PE=3 SV=1 9 91 1.0E-07
sp|A3DJJ3|KAD_CLOTH Adenylate kinase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=adk PE=3 SV=1 8 79 1.0E-07
sp|Q927M8|KAD_LISIN Adenylate kinase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=adk PE=3 SV=1 8 79 6.0E-07
sp|Q5JH68|KAD_THEKO Adenylate kinase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=adk PE=3 SV=1 9 97 6.0E-07
sp|C5A5D0|KAD_THEGJ Adenylate kinase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=adk PE=3 SV=1 9 82 6.0E-07
sp|Q71WG7|KAD_LISMF Adenylate kinase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=adk PE=3 SV=1 8 79 7.0E-07
sp|C1KZF9|KAD_LISMC Adenylate kinase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=adk PE=3 SV=1 8 79 7.0E-07
sp|Q8Y449|KAD_LISMO Adenylate kinase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=adk PE=3 SV=1 8 70 1.0E-06
sp|B8DB29|KAD_LISMH Adenylate kinase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=adk PE=3 SV=1 8 79 1.0E-06
sp|Q8ETW3|KAD_OCEIH Adenylate kinase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=adk PE=3 SV=1 9 79 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004017 adenylate kinase activity Yes
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0016301 kinase activity No
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0050145 nucleoside monophosphate kinase activity No
GO:0019205 nucleobase-containing compound kinase activity No
GO:0016776 phosphotransferase activity, phosphate group as acceptor No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.282 0.1201 0.0425 0.0181 0.9766 0.098 0.0206 0.1152 0.0765 0.0586

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 130.15 72.12 188.18
CcL In ants, during behavior modification 29.50 12.26 46.74
CcD In ants, recently dead 30.11 12.91 47.30

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.000286 yes
CcL CcD 0.956668 no

Orthologs

Orthofinder run ID4
Orthogroup2731
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5348
Ophiocordyceps australis map64 (Brazil) OphauB2|7835
Ophiocordyceps camponoti-floridani Ophcf2|02594
Ophiocordyceps camponoti-rufipedis Ophun1|5956
Ophiocordyceps kimflemingae Ophio5|8049 (this protein)
Ophiocordyceps subramaniannii Hirsu2|4304

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8049
MKLRRAARVILVGAPGVGKGTQSERLLQRFPQLQSVSAGDLLRNNVKKRTPLGILAERTMSSGGLVADDLMLRLI
SSELRRRGWLFGHGLPALMTLSTEATGASPPAAEPEPSPPPFASLVNPGLHASSIPQAPPPRASDDPSASFILDG
YPRTASQANTLDAIIPINLAVSIKTPFSVILDRIAGRWVHEPSGRVYNTSFNAPRVPGRDDLTGEALVQRADDSA
HIYRARYQKFLETSEPLLEHYARKGVLLEVDGITSDEISPKLYREFEMRFAG
Coding >Ophio5|8049
ATGAAGCTTCGGAGGGCCGCGCGCGTCATTCTAGTCGGCGCTCCGGGCGTCGGCAAGGGCACTCAGAGCGAGAGG
CTTCTCCAGCGCTTCCCGCAGCTTCAGTCCGTCAGCGCCGGCGATCTGCTCCGCAACAATGTCAAGAAGCGGACG
CCCCTCGGCATCTTGGCCGAGCGAACCATGTCTTCCGGCGGCCTTGTCGCCGACGACCTGATGCTGCGCCTCATC
TCCTCGGAGCTCCGCCGCCGCGGCTGGCTCTTCGGCCACGGACTCCCCGCTCTCATGACTCTCTCGACCGAAGCC
ACCGGCGCCTCTCCGCCAGCTGCCGAACCCGAGCCGTCTCCGCCCCCATTTGCCTCCCTCGTCAATCCCGGCCTG
CACGCCTCGTCAATACCGCAAGCGCCGCCTCCCCGCGCCTCCGACGACCCCTCCGCCTCCTTCATCCTCGACGGC
TACCCTCGCACCGCCTCTCAAGCCAACACGCTCGACGCCATCATCCCCATCAACCTCGCCGTCTCCATAAAGACG
CCCTTTTCTGTCATCCTCGACCGCATTGCCGGCCGCTGGGTCCACGAGCCCTCGGGTCGCGTCTACAATACCTCG
TTTAATGCGCCTCGCGTCCCCGGCCGCGACGACCTCACAGGCGAGGCTCTCGTCCAGCGCGCAGACGACTCGGCA
CACATCTACCGCGCACGATACCAAAAGTTTCTGGAGACGAGCGAGCCTTTGCTAGAACACTACGCTAGAAAGGGC
GTTTTGCTCGAGGTTGACGGCATAACGAGCGACGAGATTAGCCCCAAGCTATATCGGGAGTTTGAGATGCGCTTT
GCCGGC
Transcript >Ophio5|8049
ATGAAGCTTCGGAGGGCCGCGCGCGTCATTCTAGTCGGCGCTCCGGGCGTCGGCAAGGGCACTCAGAGCGAGAGG
CTTCTCCAGCGCTTCCCGCAGCTTCAGTCCGTCAGCGCCGGCGATCTGCTCCGCAACAATGTCAAGAAGCGGACG
CCCCTCGGCATCTTGGCCGAGCGAACCATGTCTTCCGGCGGCCTTGTCGCCGACGACCTGATGCTGCGCCTCATC
TCCTCGGAGCTCCGCCGCCGCGGCTGGCTCTTCGGCCACGGACTCCCCGCTCTCATGACTCTCTCGACCGAAGCC
ACCGGCGCCTCTCCGCCAGCTGCCGAACCCGAGCCGTCTCCGCCCCCATTTGCCTCCCTCGTCAATCCCGGCCTG
CACGCCTCGTCAATACCGCAAGCGCCGCCTCCCCGCGCCTCCGACGACCCCTCCGCCTCCTTCATCCTCGACGGC
TACCCTCGCACCGCCTCTCAAGCCAACACGCTCGACGCCATCATCCCCATCAACCTCGCCGTCTCCATAAAGACG
CCCTTTTCTGTCATCCTCGACCGCATTGCCGGCCGCTGGGTCCACGAGCCCTCGGGTCGCGTCTACAATACCTCG
TTTAATGCGCCTCGCGTCCCCGGCCGCGACGACCTCACAGGCGAGGCTCTCGTCCAGCGCGCAGACGACTCGGCA
CACATCTACCGCGCACGATACCAAAAGTTTCTGGAGACGAGCGAGCCTTTGCTAGAACACTACGCTAGAAAGGGC
GTTTTGCTCGAGGTTGACGGCATAACGAGCGACGAGATTAGCCCCAAGCTATATCGGGAGTTTGAGATGCGCTTT
GCCGGCTGA
Gene >Ophio5|8049
ATGAAGCTTCGGAGGGCCGCGCGCGTCATTCTAGTCGGCGCTCCGGGCGTCGGCAAGGGCACTCAGAGCGAGAGG
CTTCTCCAGCGCTTCCCGCAGCTTCAGTCCGTCAGCGCCGGCGATCTGCTCCGCAACAATGTCAAGAAGCGGACG
CCCCTCGGTCCGTCATCGTCCCCCTTCCTACTCACGTCGCCAACTAACATACCATGCGCAGGCATCTTGGCCGAG
CGAACCATGTCTTCCGGCGGCCTTGTCGCCGACGACCTGATGCTGCGCCTCATCTCCTCGGAGCTCCGCCGCCGC
GGCTGGCTCTTCGGCCACGGACTCCCCGCTCTCATGACTCTCTCGACCGAAGCCACCGGCGCCTCTCCGCCAGCT
GCCGAACCCGAGCCGTCTCCGCCCCCATTTGCCTCCCTCGTCAATCCCGGCCTGCACGCCTCGTCAATACCGCAA
GCGCCGCCTCCCCGCGCCTCCGACGACCCCTCCGCCTCCTTCATCCTCGACGGCTACCCTCGCACCGCCTCTCAA
GCCAACACGCTCGACGCCATCATCCCCATCAACCTCGCCGTCTCCATAAAGACGCCCTTTTCTGTCATCCTCGAC
CGCATTGCCGGCCGCTGGGTCCACGAGCCCTCGGGTCGCGTCTACAATACCTCGTTTAATGCGCCTCGCGTCCCC
GGCCGCGACGACCTCACAGGCGAGGCTCTCGTCCAGCGCGCAGACGACTCGGCACACATCTACCGCGCACGATAC
CAAAAGTTTCTGGAGACGAGCGAGCCTTTGCTAGAACACTACGCTAGAAAGGGCGTTTTGCTCGAGGTTGACGGC
ATAACGAGCGACGAGATTAGCCCCAAGCTATATCGGGAGTTTGAGATGCGCTTTGCCGGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail