Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8048
Gene name
Locationscaffold_85:8381..9863
Strand+
Gene length (bp)1482
Transcript length (bp)1317
Coding sequence length (bp)1314
Protein length (aa) 438

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.7E-19 53 303

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O60669|MOT2_HUMAN Monocarboxylate transporter 2 OS=Homo sapiens GN=SLC16A7 PE=1 SV=2 41 425 6.0E-14
sp|Q08268|MCH4_YEAST Probable transporter MCH4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH4 PE=1 SV=1 1 361 2.0E-13
sp|P53918|ESBP6_YEAST Uncharacterized transporter ESBP6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ESBP6 PE=1 SV=1 35 427 2.0E-13
sp|P37662|YHJX_ECOLI Uncharacterized MFS-type transporter YhjX OS=Escherichia coli (strain K12) GN=yhjX PE=1 SV=1 60 390 5.0E-13
sp|Q8K1C7|MOT14_MOUSE Monocarboxylate transporter 14 OS=Mus musculus GN=Slc16a14 PE=2 SV=1 1 221 9.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O60669|MOT2_HUMAN Monocarboxylate transporter 2 OS=Homo sapiens GN=SLC16A7 PE=1 SV=2 41 425 6.0E-14
sp|Q08268|MCH4_YEAST Probable transporter MCH4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH4 PE=1 SV=1 1 361 2.0E-13
sp|P53918|ESBP6_YEAST Uncharacterized transporter ESBP6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ESBP6 PE=1 SV=1 35 427 2.0E-13
sp|P37662|YHJX_ECOLI Uncharacterized MFS-type transporter YhjX OS=Escherichia coli (strain K12) GN=yhjX PE=1 SV=1 60 390 5.0E-13
sp|Q8K1C7|MOT14_MOUSE Monocarboxylate transporter 14 OS=Mus musculus GN=Slc16a14 PE=2 SV=1 1 221 9.0E-13
sp|Q91Y77|MOT10_RAT Monocarboxylate transporter 10 OS=Rattus norvegicus GN=Slc16a10 PE=1 SV=1 33 393 1.0E-11
sp|Q7RTX9|MOT14_HUMAN Monocarboxylate transporter 14 OS=Homo sapiens GN=SLC16A14 PE=2 SV=1 1 221 1.0E-11
sp|Q8K1P8|MOT8_RAT Monocarboxylate transporter 8 OS=Rattus norvegicus GN=SLC16A2 PE=1 SV=1 41 423 3.0E-11
sp|Q08777|MCH5_YEAST Riboflavin transporter MCH5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH5 PE=1 SV=2 3 427 1.0E-10
sp|O70451|MOT2_MOUSE Monocarboxylate transporter 2 OS=Mus musculus GN=Slc16a7 PE=1 SV=1 41 425 4.0E-10
sp|Q3U9N9|MOT10_MOUSE Monocarboxylate transporter 10 OS=Mus musculus GN=Slc16a10 PE=1 SV=1 41 426 4.0E-10
sp|Q63344|MOT2_RAT Monocarboxylate transporter 2 OS=Rattus norvegicus GN=Slc16a7 PE=1 SV=1 41 353 5.0E-10
sp|Q7RTY0|MOT13_HUMAN Monocarboxylate transporter 13 OS=Homo sapiens GN=SLC16A13 PE=2 SV=1 41 392 9.0E-10
sp|Q8TF71|MOT10_HUMAN Monocarboxylate transporter 10 OS=Homo sapiens GN=SLC16A10 PE=1 SV=1 9 419 1.0E-09
sp|Q6GM59|MOT12_XENLA Monocarboxylate transporter 12 OS=Xenopus laevis GN=slc16a12 PE=2 SV=1 41 418 1.0E-09
sp|O70324|MOT8_MOUSE Monocarboxylate transporter 8 OS=Mus musculus GN=Slc16a2 PE=1 SV=2 41 423 2.0E-09
sp|Q8CE94|MOT13_MOUSE Monocarboxylate transporter 13 OS=Mus musculus GN=Slc16a13 PE=2 SV=1 41 358 2.0E-09
sp|P53988|MOT2_MESAU Monocarboxylate transporter 2 OS=Mesocricetus auratus GN=SLC16A7 PE=1 SV=1 28 364 4.0E-09
sp|P36021|MOT8_HUMAN Monocarboxylate transporter 8 OS=Homo sapiens GN=SLC16A2 PE=1 SV=2 41 423 5.0E-09
sp|Q6P2X9|MOT12_XENTR Monocarboxylate transporter 12 OS=Xenopus tropicalis GN=slc16a12 PE=2 SV=1 32 426 1.0E-08
sp|Q66HE2|MOT13_RAT Monocarboxylate transporter 13 OS=Rattus norvegicus GN=Slc16a13 PE=2 SV=1 41 358 2.0E-08
sp|P57788|MOT4_CHICK Monocarboxylate transporter 4 OS=Gallus gallus GN=SLC16A3 PE=2 SV=1 72 302 2.0E-08
sp|Q17QR6|MOT13_BOVIN Monocarboxylate transporter 13 OS=Bos taurus GN=SLC16A13 PE=2 SV=1 41 358 7.0E-08
sp|Q6ZSM3|MOT12_HUMAN Monocarboxylate transporter 12 OS=Homo sapiens GN=SLC16A12 PE=1 SV=2 41 435 7.0E-08
sp|Q5ZJU0|MOT9_CHICK Monocarboxylate transporter 9 OS=Gallus gallus GN=SLC16A9 PE=2 SV=1 41 231 9.0E-08
sp|Q503M4|MT12B_DANRE Monocarboxylate transporter 12-B OS=Danio rerio GN=slc16a12b PE=2 SV=1 41 376 1.0E-07
sp|Q7TM99|MOT9_MOUSE Monocarboxylate transporter 9 OS=Mus musculus GN=Slc16a9 PE=2 SV=1 41 209 2.0E-07
sp|Q7RTY1|MOT9_HUMAN Monocarboxylate transporter 9 OS=Homo sapiens GN=SLC16A9 PE=1 SV=1 41 230 2.0E-07
sp|A1L1W9|MOT10_DANRE Monocarboxylate transporter 10 OS=Danio rerio GN=slc16a10 PE=2 SV=1 30 366 7.0E-07
sp|Q5R5M4|MOT9_PONAB Monocarboxylate transporter 9 OS=Pongo abelii GN=SLC16A9 PE=2 SV=1 41 230 1.0E-06
sp|Q8BGC3|MOT12_MOUSE Monocarboxylate transporter 12 OS=Mus musculus GN=Slc16a12 PE=2 SV=1 41 435 3.0E-06
sp|P53985|MOT1_HUMAN Monocarboxylate transporter 1 OS=Homo sapiens GN=SLC16A1 PE=1 SV=3 41 304 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.5

Transmembrane Domains

Domain # Start End Length
1 47 69 22
2 84 106 22
3 119 141 22
4 174 196 22
5 203 225 22
6 245 267 22
7 280 302 22
8 307 329 22
9 336 358 22
10 373 395 22
11 407 426 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8048
MATQDEDVSSSSSPATPRGEALAAAPKAEAATQQQDEAQLDGPRGWIVVGAASCSLFCYMGCIYSWGILQVELSQ
TTSMSLPSLTFVGSLGTSFMASISPFVGKLIRRYGYRNTALVGAFLLGLGEMLSSWVTCHLAALLVTHGCLFGVG
GGMTILPCSTAPLKWFKKHRGLAVGVVFGGSSLGAAIVGVASNFLVSSVGVPWTFRILGLILWSVCLPAAFFIGP
PSSQDSIPRLQWHLWTEPDFLFLLAAGAVSCFPVFVPPYFIPVFARSISHSSSTGIIALTIWNMSSTVGRVVAGF
MADSILGPINSLCLAILLCSLSALVIWPFASNMGILSLFAVISGIGCGAFFSLFPTVVSAVFGPENTLGVLPMLW
AGWFFGYFFGTPIASRLYALAEADADTSEYRPAAFYAGAASMLGLVFLIVLRFRRSSVVFSRV
Coding >Ophio5|8048
ATGGCGACTCAGGATGAAGACGTATCTTCCTCTTCCTCGCCAGCTACGCCGCGAGGTGAAGCTCTCGCCGCCGCA
CCAAAGGCCGAGGCTGCCACTCAGCAACAAGATGAAGCTCAGCTCGACGGGCCGAGAGGCTGGATCGTCGTCGGC
GCCGCCTCGTGTTCGCTCTTTTGCTACATGGGCTGCATCTACTCGTGGGGCATTCTGCAGGTTGAGTTATCGCAG
ACGACGTCCATGTCGCTGCCGTCGCTGACCTTTGTCGGCTCACTCGGTACCTCCTTCATGGCGTCTATAAGCCCT
TTTGTCGGAAAACTCATTCGCCGGTACGGATATCGGAACACTGCTCTCGTCGGCGCCTTTCTGCTCGGTCTGGGC
GAGATGTTGTCGAGCTGGGTGACGTGCCATCTCGCCGCTCTGCTGGTCACCCACGGCTGCCTCTTTGGCGTGGGG
GGAGGCATGACTATTCTACCCTGTTCTACGGCTCCTCTGAAATGGTTTAAGAAACATCGCGGCCTCGCCGTCGGC
GTCGTCTTTGGCGGCAGCAGCCTGGGCGCTGCCATCGTGGGCGTGGCCAGCAACTTTCTTGTCAGCAGCGTCGGC
GTACCCTGGACGTTTCGCATCCTTGGTCTCATCTTGTGGAGTGTGTGTCTGCCCGCGGCTTTTTTCATCGGCCCG
CCTTCGTCGCAGGACTCGATTCCCCGGCTTCAGTGGCACCTCTGGACTGAGCCAGATTTTCTCTTCCTGCTAGCT
GCAGGAGCCGTCTCGTGCTTCCCCGTCTTTGTGCCGCCCTACTTTATCCCGGTCTTTGCTCGATCCATCAGTCAC
TCGAGCTCAACCGGCATCATTGCCCTCACAATATGGAACATGTCGTCCACTGTCGGCCGCGTCGTCGCCGGCTTC
ATGGCTGACTCTATCCTCGGGCCCATCAACAGCCTCTGTCTGGCGATTCTTCTCTGCAGCCTCAGCGCCTTGGTC
ATCTGGCCTTTTGCTTCGAACATGGGCATCCTATCGCTGTTCGCCGTCATCAGCGGCATCGGCTGCGGCGCCTTT
TTTTCTCTTTTCCCTACCGTCGTCTCCGCCGTGTTTGGGCCGGAGAACACGCTGGGAGTACTCCCGATGCTGTGG
GCTGGCTGGTTTTTTGGATACTTTTTTGGCACACCCATAGCTTCACGCCTCTACGCGCTGGCGGAAGCCGACGCC
GACACGAGCGAGTACCGCCCAGCCGCATTTTACGCCGGAGCAGCGTCCATGTTGGGCCTTGTCTTTCTAATCGTT
CTACGCTTCCGCCGTTCGAGCGTCGTCTTCTCCCGAGTT
Transcript >Ophio5|8048
ATGGCGACTCAGGATGAAGACGTATCTTCCTCTTCCTCGCCAGCTACGCCGCGAGGTGAAGCTCTCGCCGCCGCA
CCAAAGGCCGAGGCTGCCACTCAGCAACAAGATGAAGCTCAGCTCGACGGGCCGAGAGGCTGGATCGTCGTCGGC
GCCGCCTCGTGTTCGCTCTTTTGCTACATGGGCTGCATCTACTCGTGGGGCATTCTGCAGGTTGAGTTATCGCAG
ACGACGTCCATGTCGCTGCCGTCGCTGACCTTTGTCGGCTCACTCGGTACCTCCTTCATGGCGTCTATAAGCCCT
TTTGTCGGAAAACTCATTCGCCGGTACGGATATCGGAACACTGCTCTCGTCGGCGCCTTTCTGCTCGGTCTGGGC
GAGATGTTGTCGAGCTGGGTGACGTGCCATCTCGCCGCTCTGCTGGTCACCCACGGCTGCCTCTTTGGCGTGGGG
GGAGGCATGACTATTCTACCCTGTTCTACGGCTCCTCTGAAATGGTTTAAGAAACATCGCGGCCTCGCCGTCGGC
GTCGTCTTTGGCGGCAGCAGCCTGGGCGCTGCCATCGTGGGCGTGGCCAGCAACTTTCTTGTCAGCAGCGTCGGC
GTACCCTGGACGTTTCGCATCCTTGGTCTCATCTTGTGGAGTGTGTGTCTGCCCGCGGCTTTTTTCATCGGCCCG
CCTTCGTCGCAGGACTCGATTCCCCGGCTTCAGTGGCACCTCTGGACTGAGCCAGATTTTCTCTTCCTGCTAGCT
GCAGGAGCCGTCTCGTGCTTCCCCGTCTTTGTGCCGCCCTACTTTATCCCGGTCTTTGCTCGATCCATCAGTCAC
TCGAGCTCAACCGGCATCATTGCCCTCACAATATGGAACATGTCGTCCACTGTCGGCCGCGTCGTCGCCGGCTTC
ATGGCTGACTCTATCCTCGGGCCCATCAACAGCCTCTGTCTGGCGATTCTTCTCTGCAGCCTCAGCGCCTTGGTC
ATCTGGCCTTTTGCTTCGAACATGGGCATCCTATCGCTGTTCGCCGTCATCAGCGGCATCGGCTGCGGCGCCTTT
TTTTCTCTTTTCCCTACCGTCGTCTCCGCCGTGTTTGGGCCGGAGAACACGCTGGGAGTACTCCCGATGCTGTGG
GCTGGCTGGTTTTTTGGATACTTTTTTGGCACACCCATAGCTTCACGCCTCTACGCGCTGGCGGAAGCCGACGCC
GACACGAGCGAGTACCGCCCAGCCGCATTTTACGCCGGAGCAGCGTCCATGTTGGGCCTTGTCTTTCTAATCGTT
CTACGCTTCCGCCGTTCGAGCGTCGTCTTCTCCCGAGTTTGA
Gene >Ophio5|8048
ATGGCGACTCAGGATGAAGACGTATCTTCCTCTTCCTCGCCAGCTACGCCGCGAGGTGAAGCTCTCGCCGCCGCA
CCAAAGGCCGAGGCTGCCACTCAGCAACAAGATGAAGCTCAGCTCGACGGGCCGAGAGGCTGGATCGTCGTCGGC
GCCGCCTCGTGTTCGCTCTTTTGCTACATGGGCTGCATCTACTCGTGGGGCATTCTGCAGGTTGAGTTATCGCAG
ACGACGTCCATGTCGCTGCCGTCGCTGACCTTTGTCGGCTCACTCGGTACCTCCTTCATGGCGTCTATAAGCCCT
TTTGTCGGAAAACTCATTCGCCGGTACGGATATCGGAACACTGCTCTCGTCGGCGCCTTTCTGCTCGGTCTGGGC
GAGATGTTGTCGAGCTGGGTGACGTGCCATCTCGCCGCTCTGCTGGTCACCCACGGCTGCCTCTTTGGCGTGGGG
GGAGGCATGACTATTCTAGTATGCTCAGATCGTTCTGGCATGAGACTTCTTGCTCATGTTGTTGCAGCCCTGTTC
TACGGCTCCTCTGAAATGGTTTAAGAAACATCGCGGCCTCGCCGTCGGCGTCGTCTTTGGCGGCAGCAGCCTGGG
CGCTGCCATCGTGGGCGTGGCCAGCAACTTTCTTGTCAGCAGCGTCGGCGTACCCTGGACGTTTCGCATCCTTGG
TCTCATCTTGTGGAGTGTGTGTCTGCCCGCGGCTTTTTTCATCGGCCCGCCTTCGTCGCAGGACTCGATTCCCCG
GCTTCAGTGGTGCGAATAATTCCCCTTTTCCCCAGATATCGAAGCCTCTGCCGCTGACCTTTGCTCCGTAGGCAC
CTCTGGACTGAGCCAGATTTTCTCTTCCTGCTAGCTGCAGGAGCCGTCTCGTGCTTCCCCGTCTTTGTGCCGCCC
TACTTTATCCCGGTCTTTGCTCGATCCATCAGTCACTCGAGCTCAACCGGCATCATTGCCCTCACAATATGGAAC
ATGTCGTCCACTGTCGGCCGCGTCGTCGCCGGCTTCATGGCTGACTCTATCCTCGGGCCCATCAACAGCCTCTGT
CTGGCGATTCTTCTCTGCAGCCTCAGCGCCTTGGTCATCTGGCCTTTTGCTTCGAACATGGGCATCCTATCGCTG
TTCGCCGTCATCAGCGGCATCGGCTGCGGCGCCTTTTTTTCTCTTTTCCCTACCGTCGTCTCCGCCGTGTTTGGG
CCGGAGAACACGCTGGGAGTACTCCCGATGCTGTGGGCTGGCTGGTTTTTTGGATACTTTTTTGTAAGACTCAAG
CTTTTCTCGGTGATTTCTCCAGCTCACAGCTTGCGTTTACAGGGCACACCCATAGCTTCACGCCTCTACGCGCTG
GCGGAAGCCGACGCCGACACGAGCGAGTACCGCCCAGCCGCATTTTACGCCGGAGCAGCGTCCATGTTGGGCCTT
GTCTTTCTAATCGTTCTACGCTTCCGCCGTTCGAGCGTCGTCTTCTCCCGAGTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail