Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8044
Gene name
Locationscaffold_85:382..2964
Strand+
Gene length (bp)2582
Transcript length (bp)2451
Coding sequence length (bp)2448
Protein length (aa) 816

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00082 Peptidase_S8 Subtilase family 4.5E-40 161 425
PF01483 P_proprotein Proprotein convertase P-domain 7.1E-26 499 586

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13359|KEX2_CANAW Kexin OS=Candida albicans (strain WO-1) GN=KEX2 PE=3 SV=2 4 596 0.0E+00
sp|P09231|KEX1A_KLULA Protease KEX1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KEX1 PE=3 SV=2 39 812 0.0E+00
sp|P13134|KEX2_YEAST Kexin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEX2 PE=1 SV=1 39 593 3.0E-174
sp|Q09175|KRP1_SCHPO Dibasic-processing endoprotease OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=krp1 PE=1 SV=1 10 652 4.0E-173
sp|P42781|XPR6_YARLI Dibasic-processing endoprotease OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=XPR6 PE=3 SV=1 128 770 1.0E-157
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13359|KEX2_CANAW Kexin OS=Candida albicans (strain WO-1) GN=KEX2 PE=3 SV=2 4 596 0.0E+00
sp|P09231|KEX1A_KLULA Protease KEX1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KEX1 PE=3 SV=2 39 812 0.0E+00
sp|P13134|KEX2_YEAST Kexin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEX2 PE=1 SV=1 39 593 3.0E-174
sp|Q09175|KRP1_SCHPO Dibasic-processing endoprotease OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=krp1 PE=1 SV=1 10 652 4.0E-173
sp|P42781|XPR6_YARLI Dibasic-processing endoprotease OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=XPR6 PE=3 SV=1 128 770 1.0E-157
sp|Q62849|PCSK7_RAT Proprotein convertase subtilisin/kexin type 7 OS=Rattus norvegicus GN=Pcsk7 PE=1 SV=1 120 588 4.0E-122
sp|Q61139|PCSK7_MOUSE Proprotein convertase subtilisin/kexin type 7 OS=Mus musculus GN=Pcsk7 PE=2 SV=2 120 588 8.0E-121
sp|Q16549|PCSK7_HUMAN Proprotein convertase subtilisin/kexin type 7 OS=Homo sapiens GN=PCSK7 PE=1 SV=2 120 593 9.0E-121
sp|P23377|FURIN_RAT Furin OS=Rattus norvegicus GN=Furin PE=1 SV=1 130 683 1.0E-120
sp|P09958|FURIN_HUMAN Furin OS=Homo sapiens GN=FURIN PE=1 SV=2 130 683 1.0E-120
sp|Q28193|FURIN_BOVIN Furin OS=Bos taurus GN=FURIN PE=1 SV=1 130 683 4.0E-120
sp|P23188|FURIN_MOUSE Furin OS=Mus musculus GN=Furin PE=1 SV=2 130 683 7.0E-120
sp|P29119|FURI1_XENLA Furin-1 OS=Xenopus laevis GN=furin PE=2 SV=1 111 590 2.0E-117
sp|Q78EH2|PCSK4_RAT Proprotein convertase subtilisin/kexin type 4 OS=Rattus norvegicus GN=Pcsk4 PE=2 SV=1 119 595 6.0E-112
sp|Q6UW60|PCSK4_HUMAN Proprotein convertase subtilisin/kexin type 4 OS=Homo sapiens GN=PCSK4 PE=2 SV=2 119 595 1.0E-110
sp|P29121|PCSK4_MOUSE Proprotein convertase subtilisin/kexin type 4 OS=Mus musculus GN=Pcsk4 PE=2 SV=1 119 564 1.0E-110
sp|P28840|NEC1_RAT Neuroendocrine convertase 1 OS=Rattus norvegicus GN=Pcsk1 PE=2 SV=1 26 588 7.0E-109
sp|Q9GLR1|NEC1_BOVIN Neuroendocrine convertase 1 OS=Bos taurus GN=PCSK1 PE=2 SV=1 77 588 6.0E-108
sp|P63239|NEC1_MOUSE Neuroendocrine convertase 1 OS=Mus musculus GN=Pcsk1 PE=1 SV=1 77 588 7.0E-108
sp|P63240|NEC1_MUSCO Neuroendocrine convertase 1 OS=Mus cookii GN=Pcsk1 PE=2 SV=1 77 588 7.0E-108
sp|P29120|NEC1_HUMAN Neuroendocrine convertase 1 OS=Homo sapiens GN=PCSK1 PE=1 SV=2 128 588 2.0E-107
sp|P29145|NECB_HYDVU PC3-like endoprotease variant B OS=Hydra vulgaris PE=2 SV=1 129 569 2.0E-107
sp|P29146|NECA_HYDVU PC3-like endoprotease variant A OS=Hydra vulgaris PE=2 SV=1 129 568 1.0E-106
sp|P28841|NEC2_RAT Neuroendocrine convertase 2 OS=Rattus norvegicus GN=Pcsk2 PE=1 SV=1 39 588 1.0E-104
sp|P21661|NEC2_MOUSE Neuroendocrine convertase 2 OS=Mus musculus GN=Pcsk2 PE=1 SV=1 39 588 1.0E-104
sp|P51559|BLI4_CAEEL Endoprotease bli-4 OS=Caenorhabditis elegans GN=bli-4 PE=2 SV=2 26 595 4.0E-104
sp|Q5REC2|NEC2_PONAB Neuroendocrine convertase 2 OS=Pongo abelii GN=PCSK2 PE=2 SV=1 39 588 4.0E-104
sp|P29122|PCSK6_HUMAN Proprotein convertase subtilisin/kexin type 6 OS=Homo sapiens GN=PCSK6 PE=1 SV=1 116 590 5.0E-104
sp|P16519|NEC2_HUMAN Neuroendocrine convertase 2 OS=Homo sapiens GN=PCSK2 PE=2 SV=2 39 588 5.0E-104
sp|Q63415|PCSK6_RAT Proprotein convertase subtilisin/kexin type 6 OS=Rattus norvegicus GN=Pcsk6 PE=2 SV=1 125 590 8.0E-104
sp|Q03333|NEC2_PIG Neuroendocrine convertase 2 OS=Sus scrofa GN=PCSK2 PE=2 SV=1 39 588 4.0E-103
sp|Q9GLR0|NEC2_BOVIN Neuroendocrine convertase 2 OS=Bos taurus GN=PCSK2 PE=2 SV=1 39 588 2.0E-102
sp|P30432|FUR2_DROME Furin-like protease 2 OS=Drosophila melanogaster GN=Fur2 PE=2 SV=2 130 590 1.0E-101
sp|P30430|FUR1C_DROME Furin-like protease 1, isoform 1-CRR OS=Drosophila melanogaster GN=Fur1 PE=2 SV=2 16 594 2.0E-100
sp|Q92824|PCSK5_HUMAN Proprotein convertase subtilisin/kexin type 5 OS=Homo sapiens GN=PCSK5 PE=1 SV=4 128 591 3.0E-99
sp|P41413|PCSK5_RAT Proprotein convertase subtilisin/kexin type 5 OS=Rattus norvegicus GN=Pcsk5 PE=2 SV=3 128 591 3.0E-99
sp|P26016|FUR11_DROME Furin-like protease 1, isoforms 1/1-X/2 OS=Drosophila melanogaster GN=Fur1 PE=2 SV=2 16 568 4.0E-99
sp|Q04592|PCSK5_MOUSE Proprotein convertase subtilisin/kexin type 5 OS=Mus musculus GN=Pcsk5 PE=1 SV=3 128 591 5.0E-99
sp|Q9NJ15|PCSK5_BRACL Proprotein convertase subtilisin/kexin type 5 OS=Branchiostoma californiense GN=PC6 PE=2 SV=1 19 590 3.0E-87
sp|O17798|FKPC1_CAEEL Furin-like protease kpc-1 OS=Caenorhabditis elegans GN=kpc-1 PE=1 SV=2 107 459 4.0E-85
sp|P23916|PRCA_ANAVT Calcium-dependent protease OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=prcA PE=1 SV=3 133 568 4.0E-33
sp|Q59149|PRCA_NOSS1 Calcium-dependent protease OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=prcA PE=3 SV=2 133 568 3.0E-32
sp|P42780|BPRX_DICNO Extracellular subtilisin-like protease OS=Dichelobacter nodosus PE=3 SV=1 129 524 1.0E-13
sp|P23314|EXPR_XANCP Extracellular protease OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=XCC0851 PE=3 SV=1 105 416 1.0E-10
sp|P42779|BPRV_DICNO Extracellular basic protease OS=Dichelobacter nodosus GN=bprV PE=1 SV=1 129 530 3.0E-10
sp|Q00139|VG47_ICHVA Subtilisin-like protease OS=Ictalurid herpesvirus 1 (strain Auburn) GN=ORF47 PE=3 SV=2 262 564 8.0E-10
sp|O17798|FKPC1_CAEEL Furin-like protease kpc-1 OS=Caenorhabditis elegans GN=kpc-1 PE=1 SV=2 499 588 3.0E-09
sp|P29139|ISP_PAEPO Intracellular serine protease OS=Paenibacillus polymyxa GN=isp PE=1 SV=1 161 405 4.0E-07
sp|P20724|ELYA_BACYA Alkaline elastase YaB OS=Bacillus sp. (strain YaB) GN=ale PE=1 SV=1 158 406 1.0E-06
sp|I3R794|HLY_HALMT Halolysin OS=Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4) GN=hly PE=1 SV=1 46 416 1.0E-06
sp|P35835|SUBN_BACNA Subtilisin NAT OS=Bacillus subtilis subsp. natto GN=aprN PE=1 SV=1 148 448 2.0E-06
sp|Q45670|THES_BACSJ Thermophilic serine proteinase OS=Bacillus sp. (strain AK1) PE=1 SV=1 112 447 3.0E-06
sp|P07518|SUBT_BACPU Subtilisin OS=Bacillus pumilus GN=apr PE=1 SV=1 148 452 4.0E-06
sp|P04189|SUBT_BACSU Subtilisin E OS=Bacillus subtilis (strain 168) GN=aprE PE=1 SV=3 148 448 4.0E-06
sp|P00781|SUBD_BACLI Subtilisin DY OS=Bacillus licheniformis GN=apr PE=1 SV=1 157 452 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004252 serine-type endopeptidase activity Yes
GO:0006508 proteolysis Yes
GO:0008236 serine-type peptidase activity Yes
GO:0008150 biological_process No
GO:0017171 serine hydrolase activity No
GO:0043170 macromolecule metabolic process No
GO:0019538 protein metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0006807 nitrogen compound metabolic process No
GO:0008233 peptidase activity No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0004175 endopeptidase activity No
GO:0044238 primary metabolic process No
GO:0071704 organic substance metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0008152 metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

Domain # Start End Length
1 684 706 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8044
MARREYDRYDYYVVHLANSASPDHAASELGMQLDGPMSLPDHYVLRAPKSSEDQLRLRLMDRKRRKRDVADDYVY
RHVLLARKQEPRMRLHKRIPPPPPGILQSRAFKSSLDTDSVKKQKNVMRTLDIHDPIFEEQWHLLNTRQPGHDIN
VTGLWLEGITGKDATVAIVDDGLDMSSNDLKKNYFAAGSWDFNDKGAEPRPRLSDDKHGTRCAGEVAAARNDVCG
VGAAYDARVAGIRILSKPISDADEADAMMYKNQENYIYSCSWGPRDDGRSMEAPGILIQRAILQGVQKGRGGLGS
IFVFASGNGAASDDNCNFDGYTNSIYSITVGAVDRAGHHPYYSELCSAQLVVTYSSGDGDSIHTTDVGANECTSS
HGGTSAAAPLAAGIFALVMQVRPDLSWRDLQYLAMDTAQPIDDKPESWQTTSIGKKYSHYFGYGKIDSYALVEKA
KQWTKVKPQAWFFSPWIHIKTDIPEGDHGLTAHFEVTKDMMKKANLERVEHVTITMNVNHTRRGDLSVDLVSPQN
MVSHIATARAHDTHNGGYVDWTFMTVVHWGESGIGNWSLVVRDTLANNQHRGTFVDWRMKLWGEAIDAKAAYLLP
MPETTDDDDHDKTASSIAGPVATSPGTGGQQPAPEPTMTALPTDHPERPIKPGAPTPSSTQLSPAPIDSGASSPP
SFAKAGPVWIYGAFCLIVVFCVGLGAYLWVARRRRLRNKARDSYEFELIDEEETEGINGGEKDAAGGRRGRRTRG
GELYDAFAGNSDDDDDEGRDEYRDGSQERLTPPGEAEQYVVGEESDDEGSDSVSPTDTKLLGGAAP
Coding >Ophio5|8044
ATGGCCCGTCGAGAGTACGATCGCTACGACTATTATGTCGTTCATCTCGCCAACTCCGCGTCGCCCGACCACGCC
GCCTCGGAGCTCGGCATGCAACTCGACGGTCCCATGTCGCTACCCGATCACTACGTCCTCCGTGCCCCCAAGTCG
TCTGAAGACCAGCTCCGCCTGCGCTTGATGGACCGGAAGAGGAGGAAACGAGATGTTGCGGATGACTACGTCTAT
CGCCATGTCCTTCTGGCCCGCAAACAGGAGCCGAGGATGCGGCTGCACAAGCGCATCCCTCCCCCTCCACCTGGT
ATCCTGCAATCCCGTGCCTTCAAGTCGTCGCTGGACACCGATTCGGTTAAGAAGCAAAAGAACGTGATGCGCACG
CTCGACATCCACGACCCCATTTTCGAGGAGCAGTGGCATCTCCTCAACACACGCCAACCTGGCCACGACATCAAC
GTCACGGGACTCTGGCTCGAGGGAATCACCGGCAAAGACGCCACCGTCGCCATTGTCGACGACGGCCTCGATATG
AGCAGTAATGACCTGAAGAAAAACTACTTCGCCGCCGGGTCCTGGGACTTCAATGATAAGGGCGCCGAGCCCCGT
CCGCGTCTGTCCGACGATAAGCACGGCACACGCTGCGCCGGAGAAGTAGCGGCGGCCCGAAACGACGTCTGCGGC
GTGGGCGCTGCCTACGACGCCCGCGTCGCCGGTATTCGCATCCTCAGCAAGCCCATCAGCGACGCCGATGAGGCC
GATGCCATGATGTACAAGAACCAGGAGAACTACATCTATTCGTGTTCGTGGGGACCCCGCGACGATGGCAGGTCC
ATGGAGGCGCCAGGCATCCTCATCCAGCGCGCCATCCTCCAGGGCGTTCAGAAGGGCCGTGGCGGGCTCGGCTCC
ATCTTCGTCTTTGCCAGCGGAAACGGCGCTGCCAGTGACGACAACTGCAACTTTGACGGATACACCAACTCCATC
TACAGCATCACCGTCGGCGCCGTCGACCGCGCTGGTCACCACCCGTACTATTCGGAGTTGTGTTCGGCCCAGCTC
GTCGTCACTTACAGTAGCGGCGACGGTGATTCCATTCATACCACTGACGTCGGCGCCAACGAGTGCACCTCGAGC
CACGGCGGCACGTCGGCTGCCGCCCCTCTCGCCGCCGGCATCTTCGCCCTCGTCATGCAGGTCCGCCCTGACCTG
AGCTGGAGAGACCTCCAATACCTGGCCATGGACACAGCTCAGCCCATCGATGACAAGCCCGAGAGTTGGCAAACG
ACGAGCATCGGCAAAAAGTACAGCCACTACTTTGGCTACGGCAAGATTGACAGCTACGCCCTGGTCGAAAAGGCC
AAGCAGTGGACAAAGGTGAAGCCCCAGGCTTGGTTCTTTTCGCCGTGGATCCACATCAAGACGGACATCCCAGAA
GGCGATCACGGCCTGACGGCCCACTTCGAGGTCACTAAGGACATGATGAAAAAGGCCAACCTGGAGCGCGTTGAG
CACGTCACCATCACCATGAATGTCAATCACACCCGACGCGGCGACTTGAGCGTGGACCTCGTCAGCCCGCAGAAT
ATGGTGAGTCACATTGCCACGGCGAGGGCCCACGATACACACAACGGGGGCTACGTCGACTGGACCTTTATGACT
GTTGTTCACTGGGGCGAGTCCGGTATCGGAAACTGGAGTCTGGTCGTTCGCGACACACTGGCGAATAACCAGCAC
CGCGGCACCTTTGTCGACTGGAGGATGAAGCTGTGGGGCGAGGCCATCGACGCCAAGGCCGCTTATCTCCTGCCC
ATGCCCGAGACGACGGACGACGACGATCACGACAAGACGGCGTCGTCCATCGCCGGCCCCGTTGCGACCTCGCCG
GGCACAGGTGGCCAGCAACCCGCGCCGGAGCCGACCATGACGGCCCTGCCGACAGACCACCCGGAACGTCCAATA
AAGCCCGGCGCCCCAACGCCCAGCTCCACGCAGTTGTCGCCCGCGCCCATCGACTCCGGCGCGTCGTCGCCGCCA
TCATTTGCCAAGGCGGGGCCCGTTTGGATTTACGGCGCCTTTTGCCTCATCGTCGTCTTCTGTGTCGGCCTCGGC
GCGTATTTATGGGTCGCTCGGCGTCGTCGGCTGAGGAACAAGGCGCGCGACAGCTATGAGTTTGAACTTATCGAC
GAGGAGGAGACAGAGGGCATCAACGGCGGGGAGAAGGACGCGGCGGGCGGCCGACGCGGACGACGCACTCGAGGC
GGAGAATTGTATGACGCCTTCGCCGGGAATAGCGACGACGACGATGACGAGGGCAGGGACGAATATAGAGATGGG
TCACAGGAGAGGTTGACTCCTCCGGGTGAGGCGGAGCAGTACGTCGTCGGCGAGGAGAGCGACGACGAGGGCAGC
GACAGCGTCTCCCCGACCGACACGAAGCTGCTAGGCGGCGCGGCGCCG
Transcript >Ophio5|8044
ATGGCCCGTCGAGAGTACGATCGCTACGACTATTATGTCGTTCATCTCGCCAACTCCGCGTCGCCCGACCACGCC
GCCTCGGAGCTCGGCATGCAACTCGACGGTCCCATGTCGCTACCCGATCACTACGTCCTCCGTGCCCCCAAGTCG
TCTGAAGACCAGCTCCGCCTGCGCTTGATGGACCGGAAGAGGAGGAAACGAGATGTTGCGGATGACTACGTCTAT
CGCCATGTCCTTCTGGCCCGCAAACAGGAGCCGAGGATGCGGCTGCACAAGCGCATCCCTCCCCCTCCACCTGGT
ATCCTGCAATCCCGTGCCTTCAAGTCGTCGCTGGACACCGATTCGGTTAAGAAGCAAAAGAACGTGATGCGCACG
CTCGACATCCACGACCCCATTTTCGAGGAGCAGTGGCATCTCCTCAACACACGCCAACCTGGCCACGACATCAAC
GTCACGGGACTCTGGCTCGAGGGAATCACCGGCAAAGACGCCACCGTCGCCATTGTCGACGACGGCCTCGATATG
AGCAGTAATGACCTGAAGAAAAACTACTTCGCCGCCGGGTCCTGGGACTTCAATGATAAGGGCGCCGAGCCCCGT
CCGCGTCTGTCCGACGATAAGCACGGCACACGCTGCGCCGGAGAAGTAGCGGCGGCCCGAAACGACGTCTGCGGC
GTGGGCGCTGCCTACGACGCCCGCGTCGCCGGTATTCGCATCCTCAGCAAGCCCATCAGCGACGCCGATGAGGCC
GATGCCATGATGTACAAGAACCAGGAGAACTACATCTATTCGTGTTCGTGGGGACCCCGCGACGATGGCAGGTCC
ATGGAGGCGCCAGGCATCCTCATCCAGCGCGCCATCCTCCAGGGCGTTCAGAAGGGCCGTGGCGGGCTCGGCTCC
ATCTTCGTCTTTGCCAGCGGAAACGGCGCTGCCAGTGACGACAACTGCAACTTTGACGGATACACCAACTCCATC
TACAGCATCACCGTCGGCGCCGTCGACCGCGCTGGTCACCACCCGTACTATTCGGAGTTGTGTTCGGCCCAGCTC
GTCGTCACTTACAGTAGCGGCGACGGTGATTCCATTCATACCACTGACGTCGGCGCCAACGAGTGCACCTCGAGC
CACGGCGGCACGTCGGCTGCCGCCCCTCTCGCCGCCGGCATCTTCGCCCTCGTCATGCAGGTCCGCCCTGACCTG
AGCTGGAGAGACCTCCAATACCTGGCCATGGACACAGCTCAGCCCATCGATGACAAGCCCGAGAGTTGGCAAACG
ACGAGCATCGGCAAAAAGTACAGCCACTACTTTGGCTACGGCAAGATTGACAGCTACGCCCTGGTCGAAAAGGCC
AAGCAGTGGACAAAGGTGAAGCCCCAGGCTTGGTTCTTTTCGCCGTGGATCCACATCAAGACGGACATCCCAGAA
GGCGATCACGGCCTGACGGCCCACTTCGAGGTCACTAAGGACATGATGAAAAAGGCCAACCTGGAGCGCGTTGAG
CACGTCACCATCACCATGAATGTCAATCACACCCGACGCGGCGACTTGAGCGTGGACCTCGTCAGCCCGCAGAAT
ATGGTGAGTCACATTGCCACGGCGAGGGCCCACGATACACACAACGGGGGCTACGTCGACTGGACCTTTATGACT
GTTGTTCACTGGGGCGAGTCCGGTATCGGAAACTGGAGTCTGGTCGTTCGCGACACACTGGCGAATAACCAGCAC
CGCGGCACCTTTGTCGACTGGAGGATGAAGCTGTGGGGCGAGGCCATCGACGCCAAGGCCGCTTATCTCCTGCCC
ATGCCCGAGACGACGGACGACGACGATCACGACAAGACGGCGTCGTCCATCGCCGGCCCCGTTGCGACCTCGCCG
GGCACAGGTGGCCAGCAACCCGCGCCGGAGCCGACCATGACGGCCCTGCCGACAGACCACCCGGAACGTCCAATA
AAGCCCGGCGCCCCAACGCCCAGCTCCACGCAGTTGTCGCCCGCGCCCATCGACTCCGGCGCGTCGTCGCCGCCA
TCATTTGCCAAGGCGGGGCCCGTTTGGATTTACGGCGCCTTTTGCCTCATCGTCGTCTTCTGTGTCGGCCTCGGC
GCGTATTTATGGGTCGCTCGGCGTCGTCGGCTGAGGAACAAGGCGCGCGACAGCTATGAGTTTGAACTTATCGAC
GAGGAGGAGACAGAGGGCATCAACGGCGGGGAGAAGGACGCGGCGGGCGGCCGACGCGGACGACGCACTCGAGGC
GGAGAATTGTATGACGCCTTCGCCGGGAATAGCGACGACGACGATGACGAGGGCAGGGACGAATATAGAGATGGG
TCACAGGAGAGGTTGACTCCTCCGGGTGAGGCGGAGCAGTACGTCGTCGGCGAGGAGAGCGACGACGAGGGCAGC
GACAGCGTCTCCCCGACCGACACGAAGCTGCTAGGCGGCGCGGCGCCGTAG
Gene >Ophio5|8044
ATGGCCCGTCGAGAGTACGATCGCTACGACTATTATGTCGTTCATCTCGCCAACTCCGCGTCGCCCGACCACGCC
GCCTCGGAGCTCGGCATGCAACTCGACGGTCCCATGTCGCTACCCGATCACTACGTCCTCCGTGCCCCCAAGTCG
TCTGAAGACCAGCTCCGCCTGCGCTTGATGGACCGGAAGAGGAGGAAACGAGATGTTGCGGATGACTACGTCTAT
CGCCATGTCCTTCTGGCCCGCAAACAGGAGCCGAGGATGCGGCTGCACAAGCGCATCCCTCCCCCTCCACCTGGT
ATCCTGCAATCCCGTGCCTTCAAGTCGTCGCTGGACACCGATTCGGTTAAGAAGCAAAAGAACGTGATGCGCACG
CTCGACATCCACGACCCCATTTTCGAGGAGCAGTGGCATCTCCTCAACACACGCCAACCTGGCCACGACATCAAC
GTCACGGGACTCTGGCTCGAGGGAATCACCGGCAAAGACGCCACCGTCGCCATTGTCGACGACGGCCTCGATATG
AGCAGTAATGACCTGAAGAAAAACTACTTCGCCGCCGGGTCCTGGGACTTCAATGATAAGGGCGCCGAGCCCCGT
CCGCGTCTGTCCGACGATAAGCACGGCACACGCTGCGCCGGAGAAGTAGCGGCGGCCCGAAACGACGTCTGCGGC
GTGGGCGCTGCCTACGACGCCCGCGTCGCCGGTATTCGCATCCTCAGCAAGCCCATCAGCGACGCCGATGAGGCC
GATGCCATGATGTACAAGAACCAGGAGAACTACATCTATTCGTGTTCGTGGGGACCCCGCGACGATGGCAGGTCC
ATGGAGGCGCCAGGCATCCTCATCCAGCGCGCCATCCTCCAGGGCGTTCAGAAGGGCCGTGGCGGGCTCGGCTCC
ATCTTCGTCTTTGCCAGCGGAAACGGCGCTGCCAGTGACGACAACTGCAACTTTGACGGATACACCAACTCCATC
TACAGCATCACCGTCGGCGCCGTCGACCGCGCTGGTCACCACCCGTACTATTCGGAGTTGTGTTCGGCCCAGCTC
GTCGTCACTTACAGTAGCGGCGACGGTGATTCCATTGTGCGCTCCCCTTCCCCCCCTACAGGCGAACATGCCGCC
ACCGCCCTGAGACTTGTGCTAACTGCTTTGGCCCCCTTAAGCATACCACTGACGTCGGCGCCAACGAGTGCACCT
CGAGCCACGGCGGCACGTCGGCTGCCGCCCCTCTCGCCGCCGGCATCTTCGCCCTCGTCATGCAGGTCCGCCCTG
ACCTGAGCTGGAGAGACCTCCAATACCTGGCCATGGACACAGCTCAGCCCATCGATGACAAGCCCGAGAGTTGGC
AAACGACGAGCATCGGCAAAAAGTACAGCCACTACTTTGGCTACGGCAAGATTGACAGCTACGCCCTGGTCGAAA
AGGCCAAGCAGTGGACAAAGGTGAAGCCCCAGGCTTGGTTCTTTTCGCCGTGGATCCACATCAAGACGGACATCC
CAGAAGGCGATCACGGCCTGACGGCCCACTTCGAGGTCACTAAGGACATGATGAAAAAGGCCAACCTGGAGCGCG
TTGAGCACGTCACCATCACCATGAATGTCAATCACACCCGACGCGGCGACTTGAGCGTGGACCTCGTCAGCCCGC
AGAATATGGTGAGTCACATTGCCACGGCGAGGGCCCACGATACACACAACGGGGGCTACGTCGACTGGACCTTTA
TGACTGTTGTTCACTGGTGAGTTAGTGTCGTTCTATGGTCCATGCCCGCACTGACGGCTTCCTGCAGGGGCGAGT
CCGGTATCGGAAACTGGAGTCTGGTCGTTCGCGACACACTGGCGAATAACCAGCACCGCGGCACCTTTGTCGACT
GGAGGATGAAGCTGTGGGGCGAGGCCATCGACGCCAAGGCCGCTTATCTCCTGCCCATGCCCGAGACGACGGACG
ACGACGATCACGACAAGACGGCGTCGTCCATCGCCGGCCCCGTTGCGACCTCGCCGGGCACAGGTGGCCAGCAAC
CCGCGCCGGAGCCGACCATGACGGCCCTGCCGACAGACCACCCGGAACGTCCAATAAAGCCCGGCGCCCCAACGC
CCAGCTCCACGCAGTTGTCGCCCGCGCCCATCGACTCCGGCGCGTCGTCGCCGCCATCATTTGCCAAGGCGGGGC
CCGTTTGGATTTACGGCGCCTTTTGCCTCATCGTCGTCTTCTGTGTCGGCCTCGGCGCGTATTTATGGGTCGCTC
GGCGTCGTCGGCTGAGGAACAAGGCGCGCGACAGCTATGAGTTTGAACTTATCGACGAGGAGGAGACAGAGGGCA
TCAACGGCGGGGAGAAGGACGCGGCGGGCGGCCGACGCGGACGACGCACTCGAGGCGGAGAATTGTATGACGCCT
TCGCCGGGAATAGCGACGACGACGATGACGAGGGCAGGGACGAATATAGAGATGGGTCACAGGAGAGGTTGACTC
CTCCGGGTGAGGCGGAGCAGTACGTCGTCGGCGAGGAGAGCGACGACGAGGGCAGCGACAGCGTCTCCCCGACCG
ACACGAAGCTGCTAGGCGGCGCGGCGCCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail