Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8035
Gene name
Locationscaffold_845:125..684
Strand+
Gene length (bp)559
Transcript length (bp)510
Coding sequence length (bp)507
Protein length (aa) 169

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Lysosome/Vacuole Signal peptide|Transmembrane domain 0.1517 0.1336 0.1318 0.4458 0.1486 0.0057 0.3302 0.6704 0.3357 0.0036

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 13 35 22
2 40 62 22
3 119 141 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 60.11 25.89 94.33
CcL In ants, during behavior modification 42.47 11.38 73.56
CcD In ants, recently dead 25.45 8.39 42.51

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.298145 no
SC16a CcD 0.004291 yes
CcL CcD 0.147705 no

Orthologs

Orthofinder run ID4
Orthogroup16391
Change Orthofinder run
Species Protein ID
Ophiocordyceps kimflemingae Ophio5|8035 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8035
MAFWQNITLVLLFLYSLSTLATFVASAVALIISLVHAAPTRVTLATYVAMSSIIALVTLVVFRQARAGAKVGQYH
PLVIYRLTLATAILTVSAHSTTIPSDVFLKYPNTRVSGKLALRLGIISWFLGVYTLIMSTVSMAMAKTPPPLASG
GQSSPIDPQTSTHLAKETV
Coding >Ophio5|8035
ATGGCTTTCTGGCAAAACATTACACTCGTTCTGCTCTTCCTCTATTCACTCTCCACTCTGGCAACCTTCGTGGCG
TCAGCTGTCGCCCTCATCATCAGTTTGGTTCACGCAGCCCCTACGCGCGTCACTTTGGCCACTTATGTGGCCATG
TCATCCATCATTGCCCTCGTCACGTTGGTCGTCTTCCGACAGGCCAGGGCCGGGGCCAAAGTCGGCCAGTACCAT
CCGTTGGTGATTTATCGCCTCACTCTGGCCACCGCAATCCTCACGGTCTCTGCACACTCTACCACCATTCCCTCC
GATGTATTCCTCAAATACCCCAATACACGCGTTAGCGGGAAACTTGCCTTGAGACTGGGCATCATCAGTTGGTTT
CTCGGCGTCTACACATTGATCATGTCTACCGTCTCGATGGCCATGGCTAAAACTCCTCCACCTTTGGCCTCGGGT
GGCCAATCTTCCCCAATCGATCCACAGACATCTACACACTTAGCCAAGGAAACCGTT
Transcript >Ophio5|8035
ATGGCTTTCTGGCAAAACATTACACTCGTTCTGCTCTTCCTCTATTCACTCTCCACTCTGGCAACCTTCGTGGCG
TCAGCTGTCGCCCTCATCATCAGTTTGGTTCACGCAGCCCCTACGCGCGTCACTTTGGCCACTTATGTGGCCATG
TCATCCATCATTGCCCTCGTCACGTTGGTCGTCTTCCGACAGGCCAGGGCCGGGGCCAAAGTCGGCCAGTACCAT
CCGTTGGTGATTTATCGCCTCACTCTGGCCACCGCAATCCTCACGGTCTCTGCACACTCTACCACCATTCCCTCC
GATGTATTCCTCAAATACCCCAATACACGCGTTAGCGGGAAACTTGCCTTGAGACTGGGCATCATCAGTTGGTTT
CTCGGCGTCTACACATTGATCATGTCTACCGTCTCGATGGCCATGGCTAAAACTCCTCCACCTTTGGCCTCGGGT
GGCCAATCTTCCCCAATCGATCCACAGACATCTACACACTTAGCCAAGGAAACCGTTTAA
Gene >Ophio5|8035
ATGGCTTTCTGGCAAAACATTACACTCGTTCTGCTCTTCCTCTATTCACTCTCCACTCTGGCAACCTTCGTGGCG
TCAGCTGTCGCCCTCATCATCAGTTTGGTTCACGCAGCCCCTACGCGCGTCACTTTGGCCACTTATGTGGCCATG
TCATCCATCATTGCCCTCGTCACGTTGGTCGTCTTCCGACAGGCCAGGGCCGGGGCCAAAGTCGGCCAGTACCAT
CCGTTGGTGATTTATCGCCTCACTCTGGCCACCGCAATCCTCACGGTCTCTGCACACTCTACCACCATTCCCTCC
GATGTATTCCTCAAATACCCCAATACACGCGTTAGCGGGAAACTTGCCTTGAGACTGGGCATCATCAGTTGGTAG
GTGACCCAAATACCGGCCTTGTCGACAACTCTAACGCTGCCTCAGGTTTCTCGGCGTCTACACATTGATCATGTC
TACCGTCTCGATGGCCATGGCTAAAACTCCTCCACCTTTGGCCTCGGGTGGCCAATCTTCCCCAATCGATCCACA
GACATCTACACACTTAGCCAAGGAAACCGTTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail