Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8027
Gene name
Locationscaffold_842:4322..5171
Strand+
Gene length (bp)849
Transcript length (bp)849
Coding sequence length (bp)846
Protein length (aa) 282

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P50082|AMA1_YEAST Meiosis-specific APC/C activator protein AMA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AMA1 PE=1 SV=2 110 274 1.0E-31
sp|O94411|MFR2_SCHPO Meiotic fizzy-related protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfr2 PE=1 SV=1 108 274 5.0E-29
sp|Q09786|YA98_SCHPO Uncharacterized WD repeat-containing protein C13G6.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC13G6.08 PE=3 SV=1 4 280 3.0E-25
sp|Q54KM3|CDH1_DICDI Anaphase-promoting complex subunit cdh1 OS=Dictyostelium discoideum GN=cdh1 PE=3 SV=1 10 249 3.0E-22
sp|P78972|SLP1_SCHPO WD repeat-containing protein slp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=slp1 PE=1 SV=1 10 248 1.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P50082|AMA1_YEAST Meiosis-specific APC/C activator protein AMA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AMA1 PE=1 SV=2 110 274 1.0E-31
sp|O94411|MFR2_SCHPO Meiotic fizzy-related protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfr2 PE=1 SV=1 108 274 5.0E-29
sp|Q09786|YA98_SCHPO Uncharacterized WD repeat-containing protein C13G6.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC13G6.08 PE=3 SV=1 4 280 3.0E-25
sp|Q54KM3|CDH1_DICDI Anaphase-promoting complex subunit cdh1 OS=Dictyostelium discoideum GN=cdh1 PE=3 SV=1 10 249 3.0E-22
sp|P78972|SLP1_SCHPO WD repeat-containing protein slp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=slp1 PE=1 SV=1 10 248 1.0E-21
sp|Q54MZ3|CDC20_DICDI Anaphase-promoting complex subunit cdc20 OS=Dictyostelium discoideum GN=cdc20 PE=1 SV=1 4 244 8.0E-20
sp|Q9S7I8|CDC22_ARATH Cell division cycle 20.2, cofactor of APC complex OS=Arabidopsis thaliana GN=CDC20-2 PE=1 SV=1 10 244 1.0E-18
sp|Q8VZS9|FZR1_ARATH Protein FIZZY-RELATED 1 OS=Arabidopsis thaliana GN=FZR1 PE=1 SV=1 4 249 4.0E-17
sp|Q8LPL5|FZR3_ARATH Protein FIZZY-RELATED 3 OS=Arabidopsis thaliana GN=FZR3 PE=1 SV=1 110 249 7.0E-17
sp|Q9R1K5|FZR_MOUSE Fizzy-related protein homolog OS=Mus musculus GN=Fzr1 PE=1 SV=1 10 244 9.0E-17
sp|Q9UM11|FZR_HUMAN Fizzy-related protein homolog OS=Homo sapiens GN=FZR1 PE=1 SV=2 10 244 1.0E-16
sp|Q8L3Z8|FZR2_ARATH Protein FIZZY-RELATED 2 OS=Arabidopsis thaliana GN=FZR2 PE=1 SV=1 110 249 1.0E-15
sp|Q9SZA4|CDC21_ARATH Cell division cycle 20.1, cofactor of APC complex OS=Arabidopsis thaliana GN=CDC20-1 PE=1 SV=1 10 244 2.0E-15
sp|O13286|SRW1_SCHPO WD repeat-containing protein srw1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=srw1 PE=1 SV=1 7 248 2.0E-15
sp|Q4PSE4|CDC24_ARATH Cell division cycle 20.4, cofactor of APC complex OS=Arabidopsis thaliana GN=CDC20-4 PE=2 SV=1 83 199 4.0E-15
sp|F4K5R6|CDC26_ARATH Cell division cycle 20.6, cofactor of APC complex OS=Arabidopsis thaliana GN=CDC20-6 PE=3 SV=1 83 252 2.0E-14
sp|Q3E906|CD205_ARATH Cell division cycle 20.5, cofactor of APC complex OS=Arabidopsis thaliana GN=CDC20-5 PE=1 SV=2 83 252 2.0E-14
sp|Q9S7H3|CD203_ARATH Cell division cycle 20.3, cofactor of APC complex OS=Arabidopsis thaliana GN=CDC20-3 PE=3 SV=1 83 199 9.0E-14
sp|Q62623|CDC20_RAT Cell division cycle protein 20 homolog OS=Rattus norvegicus GN=Cdc20 PE=1 SV=2 110 199 8.0E-13
sp|Q9JJ66|CDC20_MOUSE Cell division cycle protein 20 homolog OS=Mus musculus GN=Cdc20 PE=1 SV=2 110 199 9.0E-13
sp|Q5H7C0|CDC20_PIG Cell division cycle protein 20 homolog OS=Sus scrofa GN=CDC20 PE=2 SV=1 110 199 5.0E-12
sp|Q12834|CDC20_HUMAN Cell division cycle protein 20 homolog OS=Homo sapiens GN=CDC20 PE=1 SV=2 110 199 6.0E-12
sp|P26309|CDC20_YEAST APC/C activator protein CDC20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC20 PE=1 SV=2 2 206 6.0E-12
sp|O94423|MFR1_SCHPO Meiotic fizzy-related protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfr1 PE=1 SV=1 110 248 2.0E-11
sp|P53197|CDH1_YEAST APC/C activator protein CDH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDH1 PE=1 SV=1 10 178 9.0E-10
sp|Q86Y33|CD20B_HUMAN Cell division cycle protein 20 homolog B OS=Homo sapiens GN=CDC20B PE=1 SV=3 96 195 1.0E-08
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal|Nuclear export signal 0.5317 0.766 0.0596 0.0698 0.0241 0.0022 0.0418 0.2199 0.1347 0.0151

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5142
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|386
Ophiocordyceps australis map64 (Brazil) OphauB2|8162
Ophiocordyceps camponoti-rufipedis Ophun1|1532
Ophiocordyceps kimflemingae Ophio5|8027 (this protein)
Ophiocordyceps subramaniannii Hirsu2|3522

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8027
MYLVAKVSLHSHQVCGLAWSPDGQVFASGGNDNLCFLLNTEEIIGEPRCADSDMRWEATTDKRGYEATRHTTAGS
GTSNSKLETGSRAAQSGSGRICHHGPGCEAQAWVHRAAVKAIAFCPWREGLVATGGGSNDKCIHFFHTSSGSALA
TIAVAAQVTSLIWSRTRREIAATFGYAQPEHCYRVAVFSWPECSQVAAIPWAGDLRALYAIPYPREDGAKGKGKI
HRGSDGCIVVASSDKTVKFHELWPIGGGATMNKSGLLGGSDILDDLDGIMKDGDVIR
Coding >Ophio5|8027
ATGTATCTGGTCGCCAAGGTGTCACTTCACAGCCATCAAGTATGTGGCCTAGCGTGGTCGCCCGATGGCCAGGTT
TTTGCGTCTGGGGGTAACGACAATCTATGTTTTCTTCTGAACACGGAAGAAATTATCGGCGAACCTAGATGCGCA
GACTCAGATATGCGCTGGGAGGCTACGACCGACAAGAGGGGTTACGAGGCGACACGGCATACCACAGCTGGATCC
GGGACCAGCAATTCGAAGCTAGAGACAGGAAGCAGAGCGGCTCAGTCTGGTAGTGGTCGCATCTGCCACCATGGC
CCCGGTTGTGAGGCGCAAGCTTGGGTCCATCGAGCAGCCGTCAAAGCCATCGCTTTCTGCCCGTGGCGCGAGGGG
TTAGTCGCCACGGGAGGCGGTTCTAACGACAAGTGCATCCATTTTTTCCACACATCTTCGGGCTCTGCATTGGCC
ACTATTGCCGTCGCCGCTCAAGTCACGTCCCTTATCTGGTCGAGGACGCGGCGTGAGATAGCTGCTACGTTTGGC
TACGCCCAGCCAGAGCATTGCTACCGTGTCGCTGTCTTCAGTTGGCCGGAATGCAGTCAAGTCGCAGCAATTCCC
TGGGCGGGTGATTTGCGAGCTCTCTATGCCATCCCTTACCCGCGGGAAGACGGTGCGAAGGGTAAGGGGAAGATT
CACCGCGGGTCTGACGGATGCATCGTGGTGGCGTCTAGCGATAAGACCGTCAAGTTCCACGAGCTATGGCCTATC
GGAGGGGGCGCAACCATGAATAAATCCGGCTTGTTGGGTGGCAGTGACATACTCGACGACTTGGACGGCATCATG
AAAGACGGCGACGTGATTCGT
Transcript >Ophio5|8027
ATGTATCTGGTCGCCAAGGTGTCACTTCACAGCCATCAAGTATGTGGCCTAGCGTGGTCGCCCGATGGCCAGGTT
TTTGCGTCTGGGGGTAACGACAATCTATGTTTTCTTCTGAACACGGAAGAAATTATCGGCGAACCTAGATGCGCA
GACTCAGATATGCGCTGGGAGGCTACGACCGACAAGAGGGGTTACGAGGCGACACGGCATACCACAGCTGGATCC
GGGACCAGCAATTCGAAGCTAGAGACAGGAAGCAGAGCGGCTCAGTCTGGTAGTGGTCGCATCTGCCACCATGGC
CCCGGTTGTGAGGCGCAAGCTTGGGTCCATCGAGCAGCCGTCAAAGCCATCGCTTTCTGCCCGTGGCGCGAGGGG
TTAGTCGCCACGGGAGGCGGTTCTAACGACAAGTGCATCCATTTTTTCCACACATCTTCGGGCTCTGCATTGGCC
ACTATTGCCGTCGCCGCTCAAGTCACGTCCCTTATCTGGTCGAGGACGCGGCGTGAGATAGCTGCTACGTTTGGC
TACGCCCAGCCAGAGCATTGCTACCGTGTCGCTGTCTTCAGTTGGCCGGAATGCAGTCAAGTCGCAGCAATTCCC
TGGGCGGGTGATTTGCGAGCTCTCTATGCCATCCCTTACCCGCGGGAAGACGGTGCGAAGGGTAAGGGGAAGATT
CACCGCGGGTCTGACGGATGCATCGTGGTGGCGTCTAGCGATAAGACCGTCAAGTTCCACGAGCTATGGCCTATC
GGAGGGGGCGCAACCATGAATAAATCCGGCTTGTTGGGTGGCAGTGACATACTCGACGACTTGGACGGCATCATG
AAAGACGGCGACGTGATTCGTTGA
Gene >Ophio5|8027
ATGTATCTGGTCGCCAAGGTGTCACTTCACAGCCATCAAGTATGTGGCCTAGCGTGGTCGCCCGATGGCCAGGTT
TTTGCGTCTGGGGGTAACGACAATCTATGTTTTCTTCTGAACACGGAAGAAATTATCGGCGAACCTAGATGCGCA
GACTCAGATATGCGCTGGGAGGCTACGACCGACAAGAGGGGTTACGAGGCGACACGGCATACCACAGCTGGATCC
GGGACCAGCAATTCGAAGCTAGAGACAGGAAGCAGAGCGGCTCAGTCTGGTAGTGGTCGCATCTGCCACCATGGC
CCCGGTTGTGAGGCGCAAGCTTGGGTCCATCGAGCAGCCGTCAAAGCCATCGCTTTCTGCCCGTGGCGCGAGGGG
TTAGTCGCCACGGGAGGCGGTTCTAACGACAAGTGCATCCATTTTTTCCACACATCTTCGGGCTCTGCATTGGCC
ACTATTGCCGTCGCCGCTCAAGTCACGTCCCTTATCTGGTCGAGGACGCGGCGTGAGATAGCTGCTACGTTTGGC
TACGCCCAGCCAGAGCATTGCTACCGTGTCGCTGTCTTCAGTTGGCCGGAATGCAGTCAAGTCGCAGCAATTCCC
TGGGCGGGTGATTTGCGAGCTCTCTATGCCATCCCTTACCCGCGGGAAGACGGTGCGAAGGGTAAGGGGAAGATT
CACCGCGGGTCTGACGGATGCATCGTGGTGGCGTCTAGCGATAAGACCGTCAAGTTCCACGAGCTATGGCCTATC
GGAGGGGGCGCAACCATGAATAAATCCGGCTTGTTGGGTGGCAGTGACATACTCGACGACTTGGACGGCATCATG
AAAGACGGCGACGTGATTCGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail