Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8011
Gene name
Locationscaffold_84:17461..18035
Strand+
Gene length (bp)574
Transcript length (bp)378
Coding sequence length (bp)375
Protein length (aa) 125

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01423 LSM LSM domain 6.9E-17 7 70

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q43582|LSM4_TOBAC Probable U6 snRNA-associated Sm-like protein LSm4 OS=Nicotiana tabacum PE=2 SV=1 1 123 6.0E-39
sp|Q9LGE6|LSM4_ORYSJ Probable U6 snRNA-associated Sm-like protein LSm4 OS=Oryza sativa subsp. japonica GN=Os01g0256900 PE=2 SV=1 1 114 1.0E-36
sp|O14352|LSM4_SCHPO Probable U6 snRNA-associated Sm-like protein LSm4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lsm4 PE=1 SV=1 1 83 2.0E-36
sp|F4K4E3|LSM4_ARATH Sm-like protein LSM4 OS=Arabidopsis thaliana GN=LSM4 PE=1 SV=1 1 83 4.0E-36
sp|Q9ZRU9|LSM4_FAGSY Probable U6 snRNA-associated Sm-like protein LSm4 OS=Fagus sylvatica GN=LSM4 PE=2 SV=1 1 85 8.0E-36
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q43582|LSM4_TOBAC Probable U6 snRNA-associated Sm-like protein LSm4 OS=Nicotiana tabacum PE=2 SV=1 1 123 6.0E-39
sp|Q9LGE6|LSM4_ORYSJ Probable U6 snRNA-associated Sm-like protein LSm4 OS=Oryza sativa subsp. japonica GN=Os01g0256900 PE=2 SV=1 1 114 1.0E-36
sp|O14352|LSM4_SCHPO Probable U6 snRNA-associated Sm-like protein LSm4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lsm4 PE=1 SV=1 1 83 2.0E-36
sp|F4K4E3|LSM4_ARATH Sm-like protein LSM4 OS=Arabidopsis thaliana GN=LSM4 PE=1 SV=1 1 83 4.0E-36
sp|Q9ZRU9|LSM4_FAGSY Probable U6 snRNA-associated Sm-like protein LSm4 OS=Fagus sylvatica GN=LSM4 PE=2 SV=1 1 85 8.0E-36
sp|Q9QXA5|LSM4_MOUSE U6 snRNA-associated Sm-like protein LSm4 OS=Mus musculus GN=Lsm4 PE=1 SV=1 1 82 1.0E-35
sp|Q9Y4Z0|LSM4_HUMAN U6 snRNA-associated Sm-like protein LSm4 OS=Homo sapiens GN=LSM4 PE=1 SV=1 1 82 2.0E-35
sp|Q3ZBK6|LSM4_BOVIN U6 snRNA-associated Sm-like protein LSm4 OS=Bos taurus GN=LSM4 PE=2 SV=1 1 82 2.0E-35
sp|Q54KX4|LSM4_DICDI Probable U6 snRNA-associated Sm-like protein LSm4 OS=Dictyostelium discoideum GN=lsm4 PE=3 SV=1 1 124 2.0E-35
sp|Q19952|LSM4_CAEEL Probable U6 snRNA-associated Sm-like protein LSm4 OS=Caenorhabditis elegans GN=lsm-4 PE=3 SV=1 1 79 1.0E-33
sp|P40070|LSM4_YEAST U6 snRNA-associated Sm-like protein LSm4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LSM4 PE=1 SV=1 1 81 5.0E-16
sp|P43321|SMD3_YEAST Small nuclear ribonucleoprotein Sm D3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMD3 PE=1 SV=1 2 73 3.0E-11
sp|Q9LM92|SMD3B_ARATH Small nuclear ribonucleoprotein SmD3b OS=Arabidopsis thaliana GN=SMD3B PE=2 SV=1 2 73 5.0E-10
sp|Q9UUC6|SMD3_SCHPO Small nuclear ribonucleoprotein Sm D3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=smd3 PE=1 SV=1 2 73 3.0E-09
sp|Q9S7E6|SMD3A_ARATH Small nuclear ribonucleoprotein SmD3a OS=Arabidopsis thaliana GN=SMD3A PE=2 SV=1 2 73 2.0E-08
sp|P62323|SMD3_XENLA Small nuclear ribonucleoprotein Sm D3 OS=Xenopus laevis GN=snrpd3 PE=2 SV=1 2 95 1.0E-07
sp|P62320|SMD3_MOUSE Small nuclear ribonucleoprotein Sm D3 OS=Mus musculus GN=Snrpd3 PE=1 SV=1 2 95 1.0E-07
sp|P62318|SMD3_HUMAN Small nuclear ribonucleoprotein Sm D3 OS=Homo sapiens GN=SNRPD3 PE=1 SV=1 2 95 1.0E-07
sp|Q17348|SMD3_CAEEL Small nuclear ribonucleoprotein Sm D3 OS=Caenorhabditis elegans GN=snr-1 PE=2 SV=2 2 122 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8011
MLPLGLLNAAQGQPMLVELKNGETLNGHLVACDTWMNLTLRDVVQTSPDGDKFLKLKEAYVKGNNIKYLRVPDEI
MELVSESQKNHQSGFRGGRGGQSRGDHGGRGGDRARGRGGGRSRGRGRGQ
Coding >Ophio5|8011
ATGCTGCCCCTCGGCTTGCTCAACGCGGCCCAGGGCCAACCAATGCTAGTGGAGCTCAAGAACGGCGAGACGCTC
AACGGCCACCTTGTCGCCTGCGATACCTGGATGAACCTCACTCTCAGAGACGTGGTGCAGACCAGTCCCGATGGC
GATAAATTCCTCAAGCTGAAAGAAGCTTACGTCAAGGGCAACAATATCAAATACCTACGGGTCCCGGATGAGATC
ATGGAGCTCGTGAGCGAATCGCAAAAGAACCACCAATCGGGCTTTCGAGGTGGCAGGGGCGGCCAGTCAAGAGGC
GATCACGGCGGTCGTGGCGGCGACAGGGCAAGGGGCCGCGGCGGGGGTCGGAGTCGCGGTCGAGGACGGGGGCAA
Transcript >Ophio5|8011
ATGCTGCCCCTCGGCTTGCTCAACGCGGCCCAGGGCCAACCAATGCTAGTGGAGCTCAAGAACGGCGAGACGCTC
AACGGCCACCTTGTCGCCTGCGATACCTGGATGAACCTCACTCTCAGAGACGTGGTGCAGACCAGTCCCGATGGC
GATAAATTCCTCAAGCTGAAAGAAGCTTACGTCAAGGGCAACAATATCAAATACCTACGGGTCCCGGATGAGATC
ATGGAGCTCGTGAGCGAATCGCAAAAGAACCACCAATCGGGCTTTCGAGGTGGCAGGGGCGGCCAGTCAAGAGGC
GATCACGGCGGTCGTGGCGGCGACAGGGCAAGGGGCCGCGGCGGGGGTCGGAGTCGCGGTCGAGGACGGGGGCAA
TGA
Gene >Ophio5|8011
ATGGTACGTCCGCCATGAATTCATCGCCATCATTTCCCTCATCTACTGACTACGCCTCGCAGCTGCCCCTCGGCT
TGCTCAACGCGGCCCAGGGCCAACCAATGCTAGTGGAGCTCAAGAACGGCGAGACGCTCAACGGCCACCTTGTCG
CCTGCGATACCTGGATGAACCTCACTCTCAGAGACGTGGTGCAGACCAGTCCCGTATGCCTTACCGTCTAAAAGT
CACCCTTCTCTCGCCCCGGGCGCTCACACCTTCTCTAGGATGGCGATAAATTCCTCAAGCTGAAAGAAGCTTACG
TCAAGGGCAACAATGTACGTTGGCTCCCGTATCCCCCTCCTCTCTACTCTGCAATGGCTCCCTCGAGACCAAATA
TGCTGACTAGCCACAGATCAAATACCTACGGGTCCCGGATGAGATCATGGAGCTCGTGAGCGAATCGCAAAAGAA
CCACCAATCGGGCTTTCGAGGTGGCAGGGGCGGCCAGTCAAGAGGCGATCACGGCGGTCGTGGCGGCGACAGGGC
AAGGGGCCGCGGCGGGGGTCGGAGTCGCGGTCGAGGACGGGGGCAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail