Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8001
Gene name
Locationscaffold_838:3437..4562
Strand+
Gene length (bp)1125
Transcript length (bp)1125
Coding sequence length (bp)1122
Protein length (aa) 374

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09439 SRPRB Signal recognition particle receptor beta subunit 3.8E-24 125 339

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P36057|SRPB_YEAST Signal recognition particle receptor subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SRP102 PE=1 SV=1 96 373 4.0E-11
sp|Q9Y5M8|SRPRB_HUMAN Signal recognition particle receptor subunit beta OS=Homo sapiens GN=SRPRB PE=1 SV=3 126 365 4.0E-08
sp|O13950|SRPB_SCHPO Signal recognition particle receptor subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=srp102 PE=3 SV=1 102 369 5.0E-08
sp|Q4FZX7|SRPRB_RAT Signal recognition particle receptor subunit beta OS=Rattus norvegicus GN=Srprb PE=2 SV=1 175 365 1.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

Domain # Start End Length
1 93 115 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8001
MYIDNLCRGDQKSRIQRSRQSSNQKNSTRDVGLGLVRTRTVSSPTPRDTHPTPGCSFSLAGLEQPLQRQARTGID
TTMTSFARLVEALMTPSLPVLILGLLIVIGAPVLLHLLVVSSSAAYTVPPSVVLVGPDGAGKTALTTLLERGSLG
RGSIQGAAKTHTSQTCHAVELNASTDSSSRRSFRNHDDASGTHTKFLLVDTPGHPKLRNAAMGSLGRERRLRAIV
FLVDAAALAEQDALAPTAAYLYDLLLFLQRRAAAAAKPSARIAVPVLIAANKMDLFTALPAAGVRSRLESEMSGI
RASRSKGLLDSGVGMDDVGTEDAWLGEFGSGDFSFEQMREFDIDVDVIGGSVMGHGAEGPDVDGWWWWMAQRVS
Coding >Ophio5|8001
ATGTACATAGACAATCTATGTCGCGGAGATCAGAAGTCGAGAATCCAAAGATCCAGACAATCTTCAAATCAAAAG
AATTCCACACGTGACGTCGGCTTGGGGTTGGTCCGTACACGTACAGTCTCTTCCCCAACTCCACGTGACACCCAC
CCGACACCGGGCTGCTCCTTCAGCCTTGCCGGCCTAGAACAGCCTCTGCAGCGCCAGGCCAGGACCGGCATCGAC
ACGACTATGACCTCGTTCGCCCGCCTCGTCGAGGCTCTCATGACACCCTCGCTTCCCGTTCTCATCCTCGGCCTC
CTCATCGTCATCGGTGCCCCCGTCCTCCTCCATCTCCTGGTGGTCTCGTCGTCGGCAGCCTACACCGTCCCTCCG
TCCGTCGTCCTCGTCGGCCCCGATGGCGCGGGAAAGACGGCCCTGACGACGCTTCTCGAACGAGGATCGCTCGGC
CGCGGAAGCATCCAAGGTGCGGCGAAGACTCACACCTCGCAGACGTGTCACGCCGTTGAACTCAACGCTTCGACC
GACTCGTCGTCCCGTCGTTCGTTTCGCAACCATGACGACGCCTCGGGAACGCATACCAAATTCCTTCTTGTCGAT
ACGCCGGGCCATCCGAAGCTTCGGAACGCCGCCATGGGCAGCTTGGGCCGCGAGCGCAGACTTCGCGCCATTGTT
TTCCTCGTCGATGCCGCCGCCCTCGCTGAACAAGACGCCCTCGCTCCGACTGCGGCCTATCTCTACGACCTGCTG
CTCTTCTTGCAAAGACGTGCCGCTGCCGCCGCCAAGCCCAGTGCTCGCATCGCCGTTCCCGTCCTGATCGCGGCC
AACAAGATGGACCTGTTCACCGCCCTGCCAGCTGCTGGCGTCCGCTCCCGCCTGGAATCAGAGATGTCGGGCATT
CGTGCGTCACGAAGCAAAGGTCTGTTGGATTCGGGCGTCGGGATGGATGACGTTGGCACCGAAGACGCCTGGCTG
GGCGAGTTTGGGTCTGGCGACTTTTCTTTCGAGCAGATGCGCGAGTTTGACATTGACGTCGACGTCATCGGGGGC
AGCGTCATGGGTCACGGGGCTGAGGGACCGGATGTTGACGGCTGGTGGTGGTGGATGGCACAGAGGGTTTCG
Transcript >Ophio5|8001
ATGTACATAGACAATCTATGTCGCGGAGATCAGAAGTCGAGAATCCAAAGATCCAGACAATCTTCAAATCAAAAG
AATTCCACACGTGACGTCGGCTTGGGGTTGGTCCGTACACGTACAGTCTCTTCCCCAACTCCACGTGACACCCAC
CCGACACCGGGCTGCTCCTTCAGCCTTGCCGGCCTAGAACAGCCTCTGCAGCGCCAGGCCAGGACCGGCATCGAC
ACGACTATGACCTCGTTCGCCCGCCTCGTCGAGGCTCTCATGACACCCTCGCTTCCCGTTCTCATCCTCGGCCTC
CTCATCGTCATCGGTGCCCCCGTCCTCCTCCATCTCCTGGTGGTCTCGTCGTCGGCAGCCTACACCGTCCCTCCG
TCCGTCGTCCTCGTCGGCCCCGATGGCGCGGGAAAGACGGCCCTGACGACGCTTCTCGAACGAGGATCGCTCGGC
CGCGGAAGCATCCAAGGTGCGGCGAAGACTCACACCTCGCAGACGTGTCACGCCGTTGAACTCAACGCTTCGACC
GACTCGTCGTCCCGTCGTTCGTTTCGCAACCATGACGACGCCTCGGGAACGCATACCAAATTCCTTCTTGTCGAT
ACGCCGGGCCATCCGAAGCTTCGGAACGCCGCCATGGGCAGCTTGGGCCGCGAGCGCAGACTTCGCGCCATTGTT
TTCCTCGTCGATGCCGCCGCCCTCGCTGAACAAGACGCCCTCGCTCCGACTGCGGCCTATCTCTACGACCTGCTG
CTCTTCTTGCAAAGACGTGCCGCTGCCGCCGCCAAGCCCAGTGCTCGCATCGCCGTTCCCGTCCTGATCGCGGCC
AACAAGATGGACCTGTTCACCGCCCTGCCAGCTGCTGGCGTCCGCTCCCGCCTGGAATCAGAGATGTCGGGCATT
CGTGCGTCACGAAGCAAAGGTCTGTTGGATTCGGGCGTCGGGATGGATGACGTTGGCACCGAAGACGCCTGGCTG
GGCGAGTTTGGGTCTGGCGACTTTTCTTTCGAGCAGATGCGCGAGTTTGACATTGACGTCGACGTCATCGGGGGC
AGCGTCATGGGTCACGGGGCTGAGGGACCGGATGTTGACGGCTGGTGGTGGTGGATGGCACAGAGGGTTTCGTGA
Gene >Ophio5|8001
ATGTACATAGACAATCTATGTCGCGGAGATCAGAAGTCGAGAATCCAAAGATCCAGACAATCTTCAAATCAAAAG
AATTCCACACGTGACGTCGGCTTGGGGTTGGTCCGTACACGTACAGTCTCTTCCCCAACTCCACGTGACACCCAC
CCGACACCGGGCTGCTCCTTCAGCCTTGCCGGCCTAGAACAGCCTCTGCAGCGCCAGGCCAGGACCGGCATCGAC
ACGACTATGACCTCGTTCGCCCGCCTCGTCGAGGCTCTCATGACACCCTCGCTTCCCGTTCTCATCCTCGGCCTC
CTCATCGTCATCGGTGCCCCCGTCCTCCTCCATCTCCTGGTGGTCTCGTCGTCGGCAGCCTACACCGTCCCTCCG
TCCGTCGTCCTCGTCGGCCCCGATGGCGCGGGAAAGACGGCCCTGACGACGCTTCTCGAACGAGGATCGCTCGGC
CGCGGAAGCATCCAAGGTGCGGCGAAGACTCACACCTCGCAGACGTGTCACGCCGTTGAACTCAACGCTTCGACC
GACTCGTCGTCCCGTCGTTCGTTTCGCAACCATGACGACGCCTCGGGAACGCATACCAAATTCCTTCTTGTCGAT
ACGCCGGGCCATCCGAAGCTTCGGAACGCCGCCATGGGCAGCTTGGGCCGCGAGCGCAGACTTCGCGCCATTGTT
TTCCTCGTCGATGCCGCCGCCCTCGCTGAACAAGACGCCCTCGCTCCGACTGCGGCCTATCTCTACGACCTGCTG
CTCTTCTTGCAAAGACGTGCCGCTGCCGCCGCCAAGCCCAGTGCTCGCATCGCCGTTCCCGTCCTGATCGCGGCC
AACAAGATGGACCTGTTCACCGCCCTGCCAGCTGCTGGCGTCCGCTCCCGCCTGGAATCAGAGATGTCGGGCATT
CGTGCGTCACGAAGCAAAGGTCTGTTGGATTCGGGCGTCGGGATGGATGACGTTGGCACCGAAGACGCCTGGCTG
GGCGAGTTTGGGTCTGGCGACTTTTCTTTCGAGCAGATGCGCGAGTTTGACATTGACGTCGACGTCATCGGGGGC
AGCGTCATGGGTCACGGGGCTGAGGGACCGGATGTTGACGGCTGGTGGTGGTGGATGGCACAGAGGGTTTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail