Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7996
Gene name
Locationscaffold_835:4149..5859
Strand+
Gene length (bp)1710
Transcript length (bp)1710
Coding sequence length (bp)1707
Protein length (aa) 569

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01694 Rhomboid Rhomboid family 4.6E-21 387 532

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q58EK4|PARL_DANRE Presenilins-associated rhomboid-like protein, mitochondrial OS=Danio rerio GN=parl PE=2 SV=1 344 536 4.0E-16
sp|P53259|PCP1_YEAST Rhomboid protein 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCP1 PE=1 SV=1 354 526 1.0E-15
sp|Q2KHV4|PARL_BOVIN Presenilins-associated rhomboid-like protein, mitochondrial OS=Bos taurus GN=PARL PE=2 SV=1 339 536 2.0E-13
sp|Q5R5H4|PARL_PONAB Presenilins-associated rhomboid-like protein, mitochondrial OS=Pongo abelii GN=PARL PE=2 SV=1 339 536 3.0E-13
sp|Q9H300|PARL_HUMAN Presenilins-associated rhomboid-like protein, mitochondrial OS=Homo sapiens GN=PARL PE=1 SV=2 339 536 3.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q58EK4|PARL_DANRE Presenilins-associated rhomboid-like protein, mitochondrial OS=Danio rerio GN=parl PE=2 SV=1 344 536 4.0E-16
sp|P53259|PCP1_YEAST Rhomboid protein 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCP1 PE=1 SV=1 354 526 1.0E-15
sp|Q2KHV4|PARL_BOVIN Presenilins-associated rhomboid-like protein, mitochondrial OS=Bos taurus GN=PARL PE=2 SV=1 339 536 2.0E-13
sp|Q5R5H4|PARL_PONAB Presenilins-associated rhomboid-like protein, mitochondrial OS=Pongo abelii GN=PARL PE=2 SV=1 339 536 3.0E-13
sp|Q9H300|PARL_HUMAN Presenilins-associated rhomboid-like protein, mitochondrial OS=Homo sapiens GN=PARL PE=1 SV=2 339 536 3.0E-13
sp|Q3B8P0|PARL_RAT Presenilins-associated rhomboid-like protein, mitochondrial OS=Rattus norvegicus GN=Parl PE=2 SV=1 339 536 4.0E-13
sp|Q5XJY4|PARL_MOUSE Presenilins-associated rhomboid-like protein, mitochondrial OS=Mus musculus GN=Parl PE=1 SV=1 339 536 1.0E-12
sp|O14364|YOHB_SCHPO Uncharacterized protein C13E7.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC13E7.11 PE=4 SV=1 332 528 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0004252 serine-type endopeptidase activity Yes
GO:0016787 hydrolase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0004175 endopeptidase activity No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0003824 catalytic activity No
GO:0005575 cellular_component No
GO:0008233 peptidase activity No
GO:0003674 molecular_function No
GO:0008236 serine-type peptidase activity No
GO:0017171 serine hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 309 331 22
2 351 370 19
3 390 412 22
4 425 447 22
5 451 473 22
6 486 505 19
7 515 534 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 48.77 26.83 70.71
CcL In ants, during behavior modification 78.31 37.24 119.38
CcD In ants, recently dead 73.33 39.93 106.73

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.047314 yes
SC16a CcD 0.069043 no
CcL CcD 0.825285 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7996
MASLLCPRVSHALLRPAVRSISWATLQASRLPWSGVCQRRDEARRSGTRLQTISRRSFFKLTSPNVITRYEDLPR
GYRDSEGLPFGGRDLYLGEIRRIFGPDMDTDEGNQLLRILHGRRVGGTLEDPAFSVHTARFTTRQMADGLAYLRK
TVPVDEVLSAGLRAEDELKLMEMQMEKKRQAAEVKAKGVTQPMEKGEVPEATSWTTETEATKEDDDVYKPDARYG
RSVLDEIRARNVAKRKAKEKALEEERQAAQSAENPGGSAVTLVSEDSHAVSSQPRRFKSAKLAEYYKKAQSPLKE
PPRMSAWQRILPSAMVVLLTVGLLAGVCAVYEEPTAQYRLFREISASQATLATLIAINVLVFACWRIPPLWKSFN
KYMIIVVGKPRAISILTSVFSHILPFHLVANLVPLWFIGTRLHDDLNRAEFLALYMACGSLGFLGSLTVFTLRGQ
LVVSTLGSSGATLGILSAYLWEIRREGFRMFGLPRDGVHGVVLLGLLTAAQLGGLCRASKYRVDFVSHLVGMAVG
VAGMELIIRKRSGGREGVRASPRAPEEEEEEEEEEKRPQGRERT
Coding >Ophio5|7996
ATGGCCAGCCTCTTGTGCCCTCGCGTCTCGCACGCCCTGCTGAGGCCCGCCGTGCGCAGCATCTCATGGGCGACA
TTGCAGGCGTCCCGCCTCCCCTGGAGCGGTGTATGCCAGCGTCGAGATGAGGCCCGGAGGTCCGGGACTCGGCTG
CAGACGATCAGCCGACGAAGCTTCTTCAAACTGACGTCGCCCAACGTCATCACCAGATACGAAGATTTGCCGCGC
GGCTACCGCGACAGCGAAGGCCTCCCGTTCGGCGGCAGAGACCTATATCTGGGCGAAATCAGGAGGATCTTTGGA
CCGGACATGGACACGGACGAGGGCAATCAACTGTTACGGATATTGCATGGCCGCAGGGTCGGGGGCACGCTTGAG
GACCCGGCCTTTTCTGTTCACACGGCTCGATTTACGACCCGGCAGATGGCCGACGGGCTGGCGTATCTGAGGAAG
ACGGTTCCGGTGGACGAAGTGCTGAGTGCCGGGCTCAGGGCCGAGGATGAGCTGAAGCTCATGGAGATGCAGATG
GAGAAGAAGCGTCAGGCGGCCGAGGTCAAGGCTAAAGGGGTGACACAGCCGATGGAGAAAGGCGAGGTTCCAGAG
GCGACAAGTTGGACGACAGAGACAGAGGCGACGAAAGAAGACGACGACGTTTACAAGCCCGATGCCAGGTACGGA
CGAAGCGTCCTGGACGAGATCCGGGCGCGCAACGTTGCGAAACGTAAAGCAAAGGAAAAGGCGCTCGAGGAGGAG
CGGCAGGCAGCGCAGTCGGCCGAGAACCCCGGCGGCAGCGCAGTCACGCTCGTGTCGGAGGATTCGCACGCGGTG
TCGAGCCAGCCGCGGAGATTCAAGAGTGCCAAGTTGGCCGAGTACTACAAAAAGGCGCAGTCGCCGCTGAAGGAG
CCGCCGCGTATGTCGGCGTGGCAGCGAATCCTGCCGTCGGCCATGGTGGTGCTCCTGACGGTCGGCCTATTGGCC
GGCGTGTGCGCCGTGTACGAGGAACCGACGGCGCAGTACCGACTATTCCGGGAGATTTCGGCATCGCAGGCGACG
CTGGCGACGCTGATTGCCATCAACGTGCTCGTCTTTGCGTGCTGGCGGATCCCGCCGCTGTGGAAGTCGTTCAAC
AAGTACATGATTATCGTGGTGGGCAAGCCCCGGGCCATTTCGATCCTGACGAGCGTCTTCTCGCATATCCTACCG
TTTCACCTGGTGGCCAACCTGGTGCCGCTGTGGTTCATCGGCACGCGGCTGCACGACGACCTGAACCGGGCCGAG
TTCCTGGCGCTGTACATGGCCTGCGGCTCGCTGGGCTTCCTGGGCAGCCTGACGGTCTTTACGCTACGCGGCCAG
CTGGTTGTGTCGACGCTGGGATCTTCGGGCGCGACGCTGGGCATCCTGTCGGCGTACCTGTGGGAGATACGGCGG
GAGGGCTTCCGCATGTTTGGCCTGCCGAGGGACGGGGTTCACGGCGTGGTGCTACTGGGGCTACTGACGGCAGCC
CAGCTGGGAGGATTGTGCAGGGCCAGCAAGTATCGAGTCGATTTCGTCTCCCACCTGGTGGGCATGGCGGTGGGT
GTCGCGGGCATGGAGCTGATTATCCGCAAGAGGAGCGGAGGCAGAGAGGGTGTCAGAGCAAGCCCGAGGGCGCCG
GAGGAGGAGGAGGAGGAGGAGGAGGAGGAGAAAAGGCCGCAAGGTCGGGAACGGACG
Transcript >Ophio5|7996
ATGGCCAGCCTCTTGTGCCCTCGCGTCTCGCACGCCCTGCTGAGGCCCGCCGTGCGCAGCATCTCATGGGCGACA
TTGCAGGCGTCCCGCCTCCCCTGGAGCGGTGTATGCCAGCGTCGAGATGAGGCCCGGAGGTCCGGGACTCGGCTG
CAGACGATCAGCCGACGAAGCTTCTTCAAACTGACGTCGCCCAACGTCATCACCAGATACGAAGATTTGCCGCGC
GGCTACCGCGACAGCGAAGGCCTCCCGTTCGGCGGCAGAGACCTATATCTGGGCGAAATCAGGAGGATCTTTGGA
CCGGACATGGACACGGACGAGGGCAATCAACTGTTACGGATATTGCATGGCCGCAGGGTCGGGGGCACGCTTGAG
GACCCGGCCTTTTCTGTTCACACGGCTCGATTTACGACCCGGCAGATGGCCGACGGGCTGGCGTATCTGAGGAAG
ACGGTTCCGGTGGACGAAGTGCTGAGTGCCGGGCTCAGGGCCGAGGATGAGCTGAAGCTCATGGAGATGCAGATG
GAGAAGAAGCGTCAGGCGGCCGAGGTCAAGGCTAAAGGGGTGACACAGCCGATGGAGAAAGGCGAGGTTCCAGAG
GCGACAAGTTGGACGACAGAGACAGAGGCGACGAAAGAAGACGACGACGTTTACAAGCCCGATGCCAGGTACGGA
CGAAGCGTCCTGGACGAGATCCGGGCGCGCAACGTTGCGAAACGTAAAGCAAAGGAAAAGGCGCTCGAGGAGGAG
CGGCAGGCAGCGCAGTCGGCCGAGAACCCCGGCGGCAGCGCAGTCACGCTCGTGTCGGAGGATTCGCACGCGGTG
TCGAGCCAGCCGCGGAGATTCAAGAGTGCCAAGTTGGCCGAGTACTACAAAAAGGCGCAGTCGCCGCTGAAGGAG
CCGCCGCGTATGTCGGCGTGGCAGCGAATCCTGCCGTCGGCCATGGTGGTGCTCCTGACGGTCGGCCTATTGGCC
GGCGTGTGCGCCGTGTACGAGGAACCGACGGCGCAGTACCGACTATTCCGGGAGATTTCGGCATCGCAGGCGACG
CTGGCGACGCTGATTGCCATCAACGTGCTCGTCTTTGCGTGCTGGCGGATCCCGCCGCTGTGGAAGTCGTTCAAC
AAGTACATGATTATCGTGGTGGGCAAGCCCCGGGCCATTTCGATCCTGACGAGCGTCTTCTCGCATATCCTACCG
TTTCACCTGGTGGCCAACCTGGTGCCGCTGTGGTTCATCGGCACGCGGCTGCACGACGACCTGAACCGGGCCGAG
TTCCTGGCGCTGTACATGGCCTGCGGCTCGCTGGGCTTCCTGGGCAGCCTGACGGTCTTTACGCTACGCGGCCAG
CTGGTTGTGTCGACGCTGGGATCTTCGGGCGCGACGCTGGGCATCCTGTCGGCGTACCTGTGGGAGATACGGCGG
GAGGGCTTCCGCATGTTTGGCCTGCCGAGGGACGGGGTTCACGGCGTGGTGCTACTGGGGCTACTGACGGCAGCC
CAGCTGGGAGGATTGTGCAGGGCCAGCAAGTATCGAGTCGATTTCGTCTCCCACCTGGTGGGCATGGCGGTGGGT
GTCGCGGGCATGGAGCTGATTATCCGCAAGAGGAGCGGAGGCAGAGAGGGTGTCAGAGCAAGCCCGAGGGCGCCG
GAGGAGGAGGAGGAGGAGGAGGAGGAGGAGAAAAGGCCGCAAGGTCGGGAACGGACGTAA
Gene >Ophio5|7996
ATGGCCAGCCTCTTGTGCCCTCGCGTCTCGCACGCCCTGCTGAGGCCCGCCGTGCGCAGCATCTCATGGGCGACA
TTGCAGGCGTCCCGCCTCCCCTGGAGCGGTGTATGCCAGCGTCGAGATGAGGCCCGGAGGTCCGGGACTCGGCTG
CAGACGATCAGCCGACGAAGCTTCTTCAAACTGACGTCGCCCAACGTCATCACCAGATACGAAGATTTGCCGCGC
GGCTACCGCGACAGCGAAGGCCTCCCGTTCGGCGGCAGAGACCTATATCTGGGCGAAATCAGGAGGATCTTTGGA
CCGGACATGGACACGGACGAGGGCAATCAACTGTTACGGATATTGCATGGCCGCAGGGTCGGGGGCACGCTTGAG
GACCCGGCCTTTTCTGTTCACACGGCTCGATTTACGACCCGGCAGATGGCCGACGGGCTGGCGTATCTGAGGAAG
ACGGTTCCGGTGGACGAAGTGCTGAGTGCCGGGCTCAGGGCCGAGGATGAGCTGAAGCTCATGGAGATGCAGATG
GAGAAGAAGCGTCAGGCGGCCGAGGTCAAGGCTAAAGGGGTGACACAGCCGATGGAGAAAGGCGAGGTTCCAGAG
GCGACAAGTTGGACGACAGAGACAGAGGCGACGAAAGAAGACGACGACGTTTACAAGCCCGATGCCAGGTACGGA
CGAAGCGTCCTGGACGAGATCCGGGCGCGCAACGTTGCGAAACGTAAAGCAAAGGAAAAGGCGCTCGAGGAGGAG
CGGCAGGCAGCGCAGTCGGCCGAGAACCCCGGCGGCAGCGCAGTCACGCTCGTGTCGGAGGATTCGCACGCGGTG
TCGAGCCAGCCGCGGAGATTCAAGAGTGCCAAGTTGGCCGAGTACTACAAAAAGGCGCAGTCGCCGCTGAAGGAG
CCGCCGCGTATGTCGGCGTGGCAGCGAATCCTGCCGTCGGCCATGGTGGTGCTCCTGACGGTCGGCCTATTGGCC
GGCGTGTGCGCCGTGTACGAGGAACCGACGGCGCAGTACCGACTATTCCGGGAGATTTCGGCATCGCAGGCGACG
CTGGCGACGCTGATTGCCATCAACGTGCTCGTCTTTGCGTGCTGGCGGATCCCGCCGCTGTGGAAGTCGTTCAAC
AAGTACATGATTATCGTGGTGGGCAAGCCCCGGGCCATTTCGATCCTGACGAGCGTCTTCTCGCATATCCTACCG
TTTCACCTGGTGGCCAACCTGGTGCCGCTGTGGTTCATCGGCACGCGGCTGCACGACGACCTGAACCGGGCCGAG
TTCCTGGCGCTGTACATGGCCTGCGGCTCGCTGGGCTTCCTGGGCAGCCTGACGGTCTTTACGCTACGCGGCCAG
CTGGTTGTGTCGACGCTGGGATCTTCGGGCGCGACGCTGGGCATCCTGTCGGCGTACCTGTGGGAGATACGGCGG
GAGGGCTTCCGCATGTTTGGCCTGCCGAGGGACGGGGTTCACGGCGTGGTGCTACTGGGGCTACTGACGGCAGCC
CAGCTGGGAGGATTGTGCAGGGCCAGCAAGTATCGAGTCGATTTCGTCTCCCACCTGGTGGGCATGGCGGTGGGT
GTCGCGGGCATGGAGCTGATTATCCGCAAGAGGAGCGGAGGCAGAGAGGGTGTCAGAGCAAGCCCGAGGGCGCCG
GAGGAGGAGGAGGAGGAGGAGGAGGAGGAGAAAAGGCCGCAAGGTCGGGAACGGACGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail