Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7986
Gene name
Locationscaffold_833:1840..3574
Strand+
Gene length (bp)1734
Transcript length (bp)1506
Coding sequence length (bp)1503
Protein length (aa) 501

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13634 Nucleoporin_FG Nucleoporin FG repeat region 8.1E-04 23 106
PF13634 Nucleoporin_FG Nucleoporin FG repeat region 9.9E+00 86 156
PF13634 Nucleoporin_FG Nucleoporin FG repeat region 1.7E-07 133 214
PF13634 Nucleoporin_FG Nucleoporin FG repeat region 4.2E-07 190 251

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|G0S4X2|NUP49_CHATD Nucleoporin NUP49 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NUP49 PE=1 SV=1 64 469 3.0E-60
sp|Q09793|NUP45_SCHPO Nucleoporin nup45 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nup45 PE=1 SV=2 37 487 3.0E-17
sp|P48837|NUP57_YEAST Nucleoporin NUP57 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP57 PE=1 SV=1 37 233 4.0E-11
sp|Q02199|NUP49_YEAST Nucleoporin NUP49/NSP49 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP49 PE=1 SV=1 65 486 4.0E-11
sp|Q54EQ8|NUP98_DICDI Nuclear pore complex protein Nup98-Nup96 OS=Dictyostelium discoideum GN=nup98 PE=3 SV=1 50 251 5.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|G0S4X2|NUP49_CHATD Nucleoporin NUP49 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NUP49 PE=1 SV=1 64 469 3.0E-60
sp|Q09793|NUP45_SCHPO Nucleoporin nup45 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nup45 PE=1 SV=2 37 487 3.0E-17
sp|P48837|NUP57_YEAST Nucleoporin NUP57 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP57 PE=1 SV=1 37 233 4.0E-11
sp|Q02199|NUP49_YEAST Nucleoporin NUP49/NSP49 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP49 PE=1 SV=1 65 486 4.0E-11
sp|Q54EQ8|NUP98_DICDI Nuclear pore complex protein Nup98-Nup96 OS=Dictyostelium discoideum GN=nup98 PE=3 SV=1 50 251 5.0E-11
sp|Q54EQ8|NUP98_DICDI Nuclear pore complex protein Nup98-Nup96 OS=Dictyostelium discoideum GN=nup98 PE=3 SV=1 43 251 2.0E-09
sp|P49687|NU145_YEAST Nucleoporin NUP145 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP145 PE=1 SV=1 35 243 3.0E-08
sp|G0SAK3|NU145_CHATD Nucleoporin NUP145 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NUP145 PE=1 SV=1 52 249 3.0E-08
sp|G0SAK3|NU145_CHATD Nucleoporin NUP145 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NUP145 PE=1 SV=1 51 232 3.0E-08
sp|P49687|NU145_YEAST Nucleoporin NUP145 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP145 PE=1 SV=1 65 247 3.0E-07
sp|G5EEH9|NUP98_CAEEL Nuclear pore complex protein Nup98-Nup96 OS=Caenorhabditis elegans GN=npp-10 PE=2 SV=1 27 241 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7986
MSLAPSASGPSALTIKTGAANSLSGNSTSLQPATLLGSQNPNTNSSGGMASLFGATQQKPAPGLFGSTSTAQPAA
GGFFSSANATSQQQPAGNSLFGGANTQQQQQQQQQQQPAASGGLFGNTSSNAQQQQQQPQTQAPSTGGPFGIAGG
QQQQQQQQPQQQSSGLFGQQTAQQQSTQPSGGLFGASTTTSTQPSGGLFGATTTSSQPAGGLFGASTANAQPAVG
GGLFGQSQAKPSGGLIGQAQAQPTNQVPAVRINYDNLRPRTRFDDLAQPVQDEIALIDKGIQRVIKMRDEIGEFM
PQHEKDIQQLGRDVKFVESKFRTVQVALNQDIQTIKVLQDLTKKNISDAQLSFKAADNLKLPTHYHQTGLFAGSP
PTSDAADAANASSTHASAQDLITYFNRVCDDVDRYKRRLDEYRSEIERDMPGVENGLYEQIRSMRNRNAANGGAV
QVQLGQVLSALRETGNAIVAQAGQIADTRERLSRLQAGMLDSGLYATGVTA
Coding >Ophio5|7986
ATGTCTCTGGCGCCATCAGCCAGCGGGCCCAGCGCTCTGACCATCAAGACCGGTGCCGCCAACTCGCTAAGTGGC
AACTCGACATCGCTGCAGCCAGCCACACTCCTCGGATCCCAGAATCCCAACACCAACTCGTCAGGCGGCATGGCC
AGCCTTTTCGGCGCGACGCAGCAAAAGCCCGCCCCGGGGCTCTTCGGTTCCACGTCGACCGCCCAGCCGGCCGCC
GGGGGCTTCTTTAGTTCTGCCAACGCGACTTCACAGCAGCAGCCTGCCGGTAACAGCTTATTTGGTGGTGCCAAC
ACACAGCAGCAGCAGCAGCAGCAGCAGCAACAACAACCCGCTGCTAGCGGCGGCTTGTTCGGTAACACATCTTCC
AACGCGCAGCAGCAACAGCAGCAGCCGCAGACCCAGGCGCCGTCCACGGGGGGGCCATTTGGCATTGCTGGCGGC
CAGCAGCAGCAGCAACAACAACAACCGCAGCAACAGAGCAGCGGTTTGTTTGGACAGCAGACCGCGCAACAGCAG
TCTACGCAGCCATCCGGGGGCTTGTTCGGGGCATCGACTACTACGAGTACACAGCCATCTGGAGGCTTGTTCGGC
GCGACCACTACGAGTAGCCAGCCAGCCGGCGGCTTGTTCGGCGCGTCCACGGCCAATGCACAGCCGGCAGTCGGA
GGAGGCCTGTTCGGCCAGTCACAGGCGAAGCCCTCTGGCGGACTCATTGGCCAGGCGCAAGCACAACCGACAAAT
CAAGTACCCGCGGTCCGTATCAACTACGATAATCTTCGGCCTCGCACCAGGTTCGACGACCTCGCCCAGCCGGTG
CAGGACGAAATCGCCCTCATCGACAAGGGCATCCAGCGCGTCATCAAGATGAGGGATGAGATCGGCGAGTTCATG
CCGCAGCACGAAAAGGACATACAGCAACTGGGTCGAGACGTCAAATTCGTCGAGTCCAAGTTTCGCACCGTCCAG
GTGGCCCTCAACCAGGACATACAGACCATCAAGGTGCTCCAGGACCTGACCAAGAAGAACATTTCCGATGCGCAG
CTGTCCTTCAAGGCGGCCGACAACCTCAAGCTGCCCACGCACTACCATCAGACGGGCCTGTTCGCCGGCTCGCCC
CCGACGTCCGACGCGGCTGACGCGGCCAACGCGTCGTCGACTCACGCCAGCGCGCAGGATCTCATCACCTACTTT
AACCGCGTGTGCGACGACGTCGACAGGTACAAGCGCCGGCTCGACGAGTACCGTTCCGAGATCGAGCGCGACATG
CCGGGCGTCGAAAACGGGCTGTACGAGCAAATCAGGTCCATGCGCAACAGAAACGCGGCCAACGGCGGGGCGGTT
CAGGTCCAGCTGGGCCAGGTGCTTTCGGCGCTGCGCGAGACGGGCAACGCCATCGTGGCGCAGGCCGGACAGATT
GCCGACACGAGGGAGAGGCTGTCGAGACTGCAGGCCGGCATGTTGGACAGTGGGCTGTACGCCACGGGCGTGACA
GCA
Transcript >Ophio5|7986
ATGTCTCTGGCGCCATCAGCCAGCGGGCCCAGCGCTCTGACCATCAAGACCGGTGCCGCCAACTCGCTAAGTGGC
AACTCGACATCGCTGCAGCCAGCCACACTCCTCGGATCCCAGAATCCCAACACCAACTCGTCAGGCGGCATGGCC
AGCCTTTTCGGCGCGACGCAGCAAAAGCCCGCCCCGGGGCTCTTCGGTTCCACGTCGACCGCCCAGCCGGCCGCC
GGGGGCTTCTTTAGTTCTGCCAACGCGACTTCACAGCAGCAGCCTGCCGGTAACAGCTTATTTGGTGGTGCCAAC
ACACAGCAGCAGCAGCAGCAGCAGCAGCAACAACAACCCGCTGCTAGCGGCGGCTTGTTCGGTAACACATCTTCC
AACGCGCAGCAGCAACAGCAGCAGCCGCAGACCCAGGCGCCGTCCACGGGGGGGCCATTTGGCATTGCTGGCGGC
CAGCAGCAGCAGCAACAACAACAACCGCAGCAACAGAGCAGCGGTTTGTTTGGACAGCAGACCGCGCAACAGCAG
TCTACGCAGCCATCCGGGGGCTTGTTCGGGGCATCGACTACTACGAGTACACAGCCATCTGGAGGCTTGTTCGGC
GCGACCACTACGAGTAGCCAGCCAGCCGGCGGCTTGTTCGGCGCGTCCACGGCCAATGCACAGCCGGCAGTCGGA
GGAGGCCTGTTCGGCCAGTCACAGGCGAAGCCCTCTGGCGGACTCATTGGCCAGGCGCAAGCACAACCGACAAAT
CAAGTACCCGCGGTCCGTATCAACTACGATAATCTTCGGCCTCGCACCAGGTTCGACGACCTCGCCCAGCCGGTG
CAGGACGAAATCGCCCTCATCGACAAGGGCATCCAGCGCGTCATCAAGATGAGGGATGAGATCGGCGAGTTCATG
CCGCAGCACGAAAAGGACATACAGCAACTGGGTCGAGACGTCAAATTCGTCGAGTCCAAGTTTCGCACCGTCCAG
GTGGCCCTCAACCAGGACATACAGACCATCAAGGTGCTCCAGGACCTGACCAAGAAGAACATTTCCGATGCGCAG
CTGTCCTTCAAGGCGGCCGACAACCTCAAGCTGCCCACGCACTACCATCAGACGGGCCTGTTCGCCGGCTCGCCC
CCGACGTCCGACGCGGCTGACGCGGCCAACGCGTCGTCGACTCACGCCAGCGCGCAGGATCTCATCACCTACTTT
AACCGCGTGTGCGACGACGTCGACAGGTACAAGCGCCGGCTCGACGAGTACCGTTCCGAGATCGAGCGCGACATG
CCGGGCGTCGAAAACGGGCTGTACGAGCAAATCAGGTCCATGCGCAACAGAAACGCGGCCAACGGCGGGGCGGTT
CAGGTCCAGCTGGGCCAGGTGCTTTCGGCGCTGCGCGAGACGGGCAACGCCATCGTGGCGCAGGCCGGACAGATT
GCCGACACGAGGGAGAGGCTGTCGAGACTGCAGGCCGGCATGTTGGACAGTGGGCTGTACGCCACGGGCGTGACA
GCATGA
Gene >Ophio5|7986
ATGTCTCTGGCGCCATCAGCCAGCGGGCCCAGCGCTCTGACCATCAAGACCGGTGCCGCCAACTCGCTGTAAGCA
AGCAACAGGCCAGCCACTATCTACAGAGCTTCCTCTTCCTTCTCCTCCTCCTCCTCCATCCTGCCTGTCCGGTTC
TTCCAACCTGTTTCGACTTGATTTGATCTGGTTTTTCCTTCTTGGCTCTGGAAGCCGCGGCTGATACGCGTCTCA
TTGCGCAGAAGTGGCAACTCGACATCGCTGCAGCCAGCCACACTCCTCGGATCCCAGAATCCCAACACCAACTCG
TCAGGCGGCATGGCCAGCCTTTTCGGCGCGACGCAGCAAAAGCCCGCCCCGGGGCTCTTCGGTTCCACGTCGACC
GCCCAGCCGGCCGCCGGGGGCTTCTTTAGTTCTGCCAACGCGACTTCACAGCAGCAGCCTGCCGGTAACAGCTTA
TTTGGTGGTGCCAACACACAGCAGCAGCAGCAGCAGCAGCAGCAACAACAACCCGCTGCTAGCGGCGGCTTGTTC
GGTAACACATCTTCCAACGCGCAGCAGCAACAGCAGCAGCCGCAGACCCAGGCGCCGTCCACGGGGGGGCCATTT
GGCATTGCTGGCGGCCAGCAGCAGCAGCAACAACAACAACCGCAGCAACAGAGCAGCGGTTTGTTTGGACAGCAG
ACCGCGCAACAGCAGTCTACGCAGCCATCCGGGGGCTTGTTCGGGGCATCGACTACTACGAGTACACAGCCATCT
GGAGGCTTGTTCGGCGCGACCACTACGAGTAGCCAGCCAGCCGGCGGCTTGTTCGGCGCGTCCACGGCCAATGCA
CAGCCGGCAGTCGGAGGAGGCCTGTTCGGCCAGTCACAGGCGAAGCCCTCTGGCGGACTCATGTGAGCGGAAAGC
CCTGACGTCTCCTACAGCGGACTGATACTGACCCGACGATGCCTTCATAGTGGCCAGGCGCAAGCACAACCGACA
AATCAAGTACCCGCGGTCCGTATCAACTACGATAATCTTCGGCCTCGCACCAGGTTCGACGACCTCGCCCAGCCG
GTGCAGGACGAAATCGCCCTCATCGACAAGGGCATCCAGCGCGTCATCAAGATGAGGGATGAGATCGGCGAGTTC
ATGCCGCAGCACGAAAAGGACATACAGCAACTGGGTCGAGACGTCAAATTCGTCGAGTCCAAGTTTCGCACCGTC
CAGGTGGCCCTCAACCAGGACATACAGACCATCAAGGTGCTCCAGGACCTGACCAAGAAGAACATTTCCGATGCG
CAGCTGTCCTTCAAGGCGGCCGACAACCTCAAGCTGCCCACGCACTACCATCAGACGGGCCTGTTCGCCGGCTCG
CCCCCGACGTCCGACGCGGCTGACGCGGCCAACGCGTCGTCGACTCACGCCAGCGCGCAGGATCTCATCACCTAC
TTTAACCGCGTGTGCGACGACGTCGACAGGTACAAGCGCCGGCTCGACGAGTACCGTTCCGAGATCGAGCGCGAC
ATGCCGGGCGTCGAAAACGGGCTGTACGAGCAAATCAGGTCCATGCGCAACAGAAACGCGGCCAACGGCGGGGCG
GTTCAGGTCCAGCTGGGCCAGGTGCTTTCGGCGCTGCGCGAGACGGGCAACGCCATCGTGGCGCAGGCCGGACAG
ATTGCCGACACGAGGGAGAGGCTGTCGAGACTGCAGGCCGGCATGTTGGACAGTGGGCTGTACGCCACGGGCGTG
ACAGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail