Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7984
Gene name
Locationscaffold_832:2443..6449
Strand-
Gene length (bp)4006
Transcript length (bp)3822
Coding sequence length (bp)3819
Protein length (aa) 1273

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02463 SMC_N RecF/RecN/SMC N terminal domain 7.3E-54 20 1258
PF06470 SMC_hinge SMC proteins Flexible Hinge Domain 1.5E-23 560 675

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P32908|SMC1_YEAST Structural maintenance of chromosomes protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMC1 PE=1 SV=1 1 1273 0.0E+00
sp|O94383|SMC1_SCHPO Structural maintenance of chromosomes protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psm1 PE=1 SV=2 1 1273 0.0E+00
sp|O93308|SMC1A_XENLA Structural maintenance of chromosomes protein 1A OS=Xenopus laevis GN=smc1a PE=1 SV=1 20 1272 0.0E+00
sp|Q9Z1M9|SMC1A_RAT Structural maintenance of chromosomes protein 1A OS=Rattus norvegicus GN=Smc1a PE=1 SV=1 20 1272 0.0E+00
sp|Q9CU62|SMC1A_MOUSE Structural maintenance of chromosomes protein 1A OS=Mus musculus GN=Smc1a PE=1 SV=4 20 1272 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P32908|SMC1_YEAST Structural maintenance of chromosomes protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMC1 PE=1 SV=1 1 1273 0.0E+00
sp|O94383|SMC1_SCHPO Structural maintenance of chromosomes protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psm1 PE=1 SV=2 1 1273 0.0E+00
sp|O93308|SMC1A_XENLA Structural maintenance of chromosomes protein 1A OS=Xenopus laevis GN=smc1a PE=1 SV=1 20 1272 0.0E+00
sp|Q9Z1M9|SMC1A_RAT Structural maintenance of chromosomes protein 1A OS=Rattus norvegicus GN=Smc1a PE=1 SV=1 20 1272 0.0E+00
sp|Q9CU62|SMC1A_MOUSE Structural maintenance of chromosomes protein 1A OS=Mus musculus GN=Smc1a PE=1 SV=4 20 1272 0.0E+00
sp|Q14683|SMC1A_HUMAN Structural maintenance of chromosomes protein 1A OS=Homo sapiens GN=SMC1A PE=1 SV=2 20 1272 0.0E+00
sp|Q6Q1P4|SMC1_ARATH Structural maintenance of chromosomes protein 1 OS=Arabidopsis thaliana GN=SMC1 PE=2 SV=2 2 1272 0.0E+00
sp|O97593|SMC1A_BOVIN Structural maintenance of chromosomes protein 1A OS=Bos taurus GN=SMC1A PE=1 SV=1 20 1272 0.0E+00
sp|Q8NDV3|SMC1B_HUMAN Structural maintenance of chromosomes protein 1B OS=Homo sapiens GN=SMC1B PE=2 SV=2 20 1272 2.0E-170
sp|Q920F6|SMC1B_MOUSE Structural maintenance of chromosomes protein 1B OS=Mus musculus GN=Smc1b PE=1 SV=1 20 1272 1.0E-162
sp|O01789|SMC1_CAEEL Structural maintenance of chromosomes protein 1 OS=Caenorhabditis elegans GN=him-1 PE=1 SV=4 14 1272 1.0E-158
sp|P50532|SMC4_XENLA Structural maintenance of chromosomes protein 4 OS=Xenopus laevis GN=smc4 PE=1 SV=1 22 1262 9.0E-71
sp|Q9NTJ3|SMC4_HUMAN Structural maintenance of chromosomes protein 4 OS=Homo sapiens GN=SMC4 PE=1 SV=2 22 1262 4.0E-66
sp|Q8CG47|SMC4_MOUSE Structural maintenance of chromosomes protein 4 OS=Mus musculus GN=Smc4 PE=1 SV=1 22 1273 3.0E-65
sp|Q9ERA5|SMC4_MICAR Structural maintenance of chromosomes protein 4 (Fragment) OS=Microtus arvalis GN=SMC4 PE=2 SV=1 22 1262 1.0E-64
sp|B8CW13|SMC_HALOH Chromosome partition protein Smc OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=smc PE=3 SV=1 23 1253 1.0E-55
sp|Q12267|SMC4_YEAST Structural maintenance of chromosomes protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMC4 PE=1 SV=1 20 1269 8.0E-55
sp|Q69GZ5|SMC_METVO Chromosome partition protein Smc OS=Methanococcus voltae GN=smc PE=3 SV=1 12 1253 3.0E-46
sp|Q54LV0|SMC4_DICDI Structural maintenance of chromosomes protein 4 OS=Dictyostelium discoideum GN=smc4 PE=3 SV=1 561 1265 5.0E-45
sp|P50533|SMC2_XENLA Structural maintenance of chromosomes protein 2 OS=Xenopus laevis GN=smc2 PE=1 SV=1 15 1250 3.0E-44
sp|Q20060|SMC4_CAEEL Structural maintenance of chromosomes protein 4 OS=Caenorhabditis elegans GN=smc-4 PE=1 SV=1 564 1255 7.0E-39
sp|O95347|SMC2_HUMAN Structural maintenance of chromosomes protein 2 OS=Homo sapiens GN=SMC2 PE=1 SV=2 15 1250 1.0E-38
sp|P48996|DPY27_CAEEL Chromosome condensation protein dpy-27 OS=Caenorhabditis elegans GN=dpy-27 PE=1 SV=1 558 1255 4.0E-38
sp|Q9C5Y4|SMC21_ARATH Structural maintenance of chromosomes protein 2-1 OS=Arabidopsis thaliana GN=SMC2-1 PE=2 SV=2 23 1265 7.0E-36
sp|Q7NG51|SMC_GLOVI Chromosome partition protein Smc OS=Gloeobacter violaceus (strain PCC 7421) GN=smc PE=3 SV=1 513 1253 8.0E-33
sp|P41004|SMC4_SCHPO Structural maintenance of chromosomes protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cut3 PE=1 SV=2 1087 1265 2.0E-31
sp|Q90988|SMC2_CHICK Structural maintenance of chromosomes protein 2 OS=Gallus gallus GN=SMC2 PE=2 SV=1 562 1266 3.0E-29
sp|Q5H054|SMC_XANOR Chromosome partition protein Smc OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=smc PE=3 SV=2 20 1273 9.0E-26
sp|P51834|SMC_BACSU Chromosome partition protein Smc OS=Bacillus subtilis (strain 168) GN=smc PE=1 SV=3 1031 1269 2.0E-24
sp|B9E1H0|SMC_CLOK1 Chromosome partition protein Smc OS=Clostridium kluyveri (strain NBRC 12016) GN=smc PE=3 SV=1 15 849 4.0E-24
sp|P41003|SMC2_SCHPO Structural maintenance of chromosomes protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cut14 PE=1 SV=2 20 701 1.0E-23
sp|Q59037|SMC_METJA Chromosome partition protein Smc OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=smc PE=3 SV=2 1041 1254 3.0E-23
sp|Q9SN90|SMC22_ARATH Structural maintenance of chromosomes protein 2-2 OS=Arabidopsis thaliana GN=SMC2-2 PE=2 SV=1 23 709 5.0E-23
sp|Q9HK21|SMC_THEAC Chromosome partition protein Smc OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=smc PE=3 SV=1 22 701 8.0E-23
sp|P51834|SMC_BACSU Chromosome partition protein Smc OS=Bacillus subtilis (strain 168) GN=smc PE=1 SV=3 20 701 1.0E-21
sp|Q59037|SMC_METJA Chromosome partition protein Smc OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=smc PE=3 SV=2 12 742 1.0E-21
sp|P73340|SMC_SYNY3 Chromosome partition protein Smc OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=smc PE=3 SV=1 1029 1253 2.0E-21
sp|Q3JR19|SMC_BURP1 Chromosome partition protein Smc OS=Burkholderia pseudomallei (strain 1710b) GN=smc PE=3 SV=2 960 1269 2.0E-21
sp|Q604U6|SMC_METCA Chromosome partition protein Smc OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=smc PE=3 SV=2 1049 1269 1.0E-20
sp|Q8REH4|SMC_FUSNN Chromosome partition protein Smc OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=smc PE=3 SV=2 15 825 2.0E-20
sp|Q7ZAK1|SMC_THEEB Chromosome partition protein Smc OS=Thermosynechococcus elongatus (strain BP-1) GN=smc PE=3 SV=1 1052 1272 3.0E-20
sp|Q9FJL0|SMC4_ARATH Structural maintenance of chromosomes protein 4 OS=Arabidopsis thaliana GN=SMC4 PE=1 SV=1 22 796 1.0E-19
sp|P9WGF3|SMC_MYCTU Chromosome partition protein Smc OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=smc PE=1 SV=1 1061 1258 2.0E-19
sp|P9WGF2|SMC_MYCTO Chromosome partition protein Smc OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=smc PE=3 SV=1 1061 1258 2.0E-19
sp|A9BZW2|SMC_DELAS Chromosome partition protein Smc OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=smc PE=3 SV=2 1052 1269 3.0E-19
sp|B9E1H0|SMC_CLOK1 Chromosome partition protein Smc OS=Clostridium kluyveri (strain NBRC 12016) GN=smc PE=3 SV=1 1055 1269 4.0E-19
sp|Q7UQV4|SMC_RHOBA Chromosome partition protein Smc OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=smc PE=3 SV=2 1025 1253 7.0E-19
sp|Q1INB1|SMC_KORVE Chromosome partition protein Smc OS=Koribacter versatilis (strain Ellin345) GN=smc PE=3 SV=1 842 1253 8.0E-19
sp|A9II65|SMC_BORPD Chromosome partition protein Smc OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=smc PE=3 SV=2 1030 1269 1.0E-18
sp|Q24U48|SMC_DESHY Chromosome partition protein Smc OS=Desulfitobacterium hafniense (strain Y51) GN=smc PE=3 SV=1 1052 1269 2.0E-18
sp|Q73VM3|SMC_MYCPA Chromosome partition protein Smc OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=smc PE=3 SV=2 1061 1258 3.0E-18
sp|Q8KBS6|SMC_CHLTE Chromosome partition protein Smc OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=smc PE=3 SV=1 560 1258 3.0E-18
sp|P75361|SMC_MYCPN Chromosome partition protein Smc OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=smc PE=3 SV=1 1055 1252 1.0E-17
sp|C4ZJU1|SMC_THASP Chromosome partition protein Smc OS=Thauera sp. (strain MZ1T) GN=smc PE=3 SV=2 1049 1269 1.0E-17
sp|E1X022|SMC_HALMS Chromosome partition protein Smc OS=Halobacteriovorax marinus (strain ATCC BAA-682 / DSM 15412 / SJ) GN=smc PE=3 SV=2 1107 1253 4.0E-17
sp|Q09591|MIX1_CAEEL Mitotic chromosome and X-chromosome-associated protein mix-1 OS=Caenorhabditis elegans GN=mix-1 PE=1 SV=2 15 819 1.0E-16
sp|P47540|SMC_MYCGE Chromosome partition protein Smc OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=smc PE=3 SV=1 1055 1252 2.0E-16
sp|Q00737|SUDA_EMENI Chromosome segregation protein sudA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sudA PE=2 SV=3 20 701 3.0E-16
sp|A3PMS2|SMC_RHOS1 Chromosome partition protein Smc OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=smc PE=3 SV=2 1046 1271 1.0E-15
sp|P41508|SMC_MYCHR Chromosome partition protein Smc OS=Mycoplasma hyorhinis GN=smc PE=1 SV=2 1059 1253 1.0E-15
sp|Q54PK4|SMC2_DICDI Structural maintenance of chromosomes protein 2 OS=Dictyostelium discoideum GN=smc2 PE=3 SV=1 515 1250 4.0E-15
sp|P15016|YAT3_RHORU Uncharacterized protein in ATPase CF(0) subunits 3'region (Fragment) OS=Rhodospirillum rubrum PE=4 SV=1 1142 1253 8.0E-15
sp|Q8CG48|SMC2_MOUSE Structural maintenance of chromosomes protein 2 OS=Mus musculus GN=Smc2 PE=1 SV=2 1054 1250 1.0E-14
sp|B8GZ28|SMC_CAUCN Chromosome partition protein Smc OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=smc PE=1 SV=1 1059 1253 2.0E-14
sp|Q9HK21|SMC_THEAC Chromosome partition protein Smc OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=smc PE=3 SV=1 1098 1253 2.0E-14
sp|Q6N1B7|SMC_RHOPA Chromosome partition protein Smc OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=smc PE=3 SV=2 1048 1238 8.0E-14
sp|Q8REH4|SMC_FUSNN Chromosome partition protein Smc OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=smc PE=3 SV=2 1069 1268 8.0E-13
sp|Q9CW03|SMC3_MOUSE Structural maintenance of chromosomes protein 3 OS=Mus musculus GN=Smc3 PE=1 SV=2 1052 1253 2.0E-12
sp|Q5R4K5|SMC3_PONAB Structural maintenance of chromosomes protein 3 OS=Pongo abelii GN=SMC3 PE=2 SV=1 1052 1253 2.0E-12
sp|Q9UQE7|SMC3_HUMAN Structural maintenance of chromosomes protein 3 OS=Homo sapiens GN=SMC3 PE=1 SV=2 1052 1253 2.0E-12
sp|Q88WJ9|SMC_LACPL Chromosome partition protein Smc OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=smc PE=3 SV=1 551 701 2.0E-12
sp|P38989|SMC2_YEAST Structural maintenance of chromosomes protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMC2 PE=1 SV=1 1065 1247 3.0E-12
sp|O97594|SMC3_BOVIN Structural maintenance of chromosomes protein 3 OS=Bos taurus GN=SMC3 PE=1 SV=1 1052 1253 5.0E-12
sp|P48996|DPY27_CAEEL Chromosome condensation protein dpy-27 OS=Caenorhabditis elegans GN=dpy-27 PE=1 SV=1 19 211 6.0E-12
sp|Q9CBT5|SMC_MYCLE Chromosome partition protein Smc OS=Mycobacterium leprae (strain TN) GN=smc PE=3 SV=1 15 703 9.0E-12
sp|Q09591|MIX1_CAEEL Mitotic chromosome and X-chromosome-associated protein mix-1 OS=Caenorhabditis elegans GN=mix-1 PE=1 SV=2 1175 1250 2.0E-11
sp|E1X022|SMC_HALMS Chromosome partition protein Smc OS=Halobacteriovorax marinus (strain ATCC BAA-682 / DSM 15412 / SJ) GN=smc PE=3 SV=2 20 278 3.0E-11
sp|P97690|SMC3_RAT Structural maintenance of chromosomes protein 3 OS=Rattus norvegicus GN=Smc3 PE=1 SV=1 1052 1252 6.0E-11
sp|Q56YN8|SMC3_ARATH Structural maintenance of chromosomes protein 3 OS=Arabidopsis thaliana GN=SMC3 PE=2 SV=1 1175 1268 8.0E-11
sp|Q552D9|SMC3_DICDI Structural maintenance of chromosomes protein 3 OS=Dictyostelium discoideum GN=smc3 PE=3 SV=1 1175 1247 2.0E-10
sp|P47037|SMC3_YEAST Structural maintenance of chromosomes protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMC3 PE=1 SV=1 1050 1245 3.0E-10
sp|P47037|SMC3_YEAST Structural maintenance of chromosomes protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMC3 PE=1 SV=1 20 701 5.0E-10
sp|Q8TZY2|SMC_PYRFU Chromosome partition protein Smc OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=smc PE=1 SV=2 23 231 3.0E-09
sp|Q5N0D2|SMC_SYNP6 Chromosome partition protein Smc OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=smc PE=3 SV=2 520 709 8.0E-09
sp|P9WGF2|SMC_MYCTO Chromosome partition protein Smc OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=smc PE=3 SV=1 15 215 1.0E-08
sp|P9WGF3|SMC_MYCTU Chromosome partition protein Smc OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=smc PE=1 SV=1 15 215 1.0E-08
sp|O66878|SMC_AQUAE Chromosome partition protein Smc OS=Aquifex aeolicus (strain VF5) GN=smc PE=3 SV=1 20 214 4.0E-08
sp|Q73VM3|SMC_MYCPA Chromosome partition protein Smc OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=smc PE=3 SV=2 15 215 8.0E-08
sp|Q56YN8|SMC3_ARATH Structural maintenance of chromosomes protein 3 OS=Arabidopsis thaliana GN=SMC3 PE=2 SV=1 561 701 2.0E-07
sp|O42649|SMC3_SCHPO Structural maintenance of chromosomes protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psm3 PE=1 SV=1 20 978 4.0E-07
sp|Q8IED2|SMC2_PLAF7 Structural maintenance of chromosomes protein 2 OS=Plasmodium falciparum (isolate 3D7) GN=MAL13P1.96 PE=3 SV=1 23 319 8.0E-07
sp|P41508|SMC_MYCHR Chromosome partition protein Smc OS=Mycoplasma hyorhinis GN=smc PE=1 SV=2 558 774 1.0E-06
sp|Q7UQV4|SMC_RHOBA Chromosome partition protein Smc OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=smc PE=3 SV=2 20 307 1.0E-06
sp|Q552D9|SMC3_DICDI Structural maintenance of chromosomes protein 3 OS=Dictyostelium discoideum GN=smc3 PE=3 SV=1 362 701 6.0E-06
sp|P47540|SMC_MYCGE Chromosome partition protein Smc OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=smc PE=3 SV=1 550 759 6.0E-06
sp|P75361|SMC_MYCPN Chromosome partition protein Smc OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=smc PE=3 SV=1 574 701 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0051276 chromosome organization Yes
GO:0005524 ATP binding Yes
GO:0005515 protein binding Yes
GO:0005694 chromosome Yes
GO:0030554 adenyl nucleotide binding No
GO:0008150 biological_process No
GO:0043168 anion binding No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0043228 non-membrane-bounded organelle No
GO:0043226 organelle No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0032555 purine ribonucleotide binding No
GO:0110165 cellular anatomical entity No
GO:0005488 binding No
GO:0009987 cellular process No
GO:0006996 organelle organization No
GO:0017076 purine nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0043229 intracellular organelle No
GO:0005575 cellular_component No
GO:0016043 cellular component organization No
GO:0032553 ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0097159 organic cyclic compound binding No
GO:0036094 small molecule binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0071840 cellular component organization or biogenesis No
GO:1901265 nucleoside phosphate binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3384 0.7289 0.1574 0.061 0.1773 0.0051 0.1314 0.1146 0.0678 0.012

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5119
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1155
Ophiocordyceps australis map64 (Brazil) OphauB2|5088
Ophiocordyceps camponoti-floridani Ophcf2|06066
Ophiocordyceps camponoti-rufipedis Ophun1|6594
Ophiocordyceps kimflemingae Ophio5|7984 (this protein)
Ophiocordyceps subramaniannii Hirsu2|3375

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7984
MGKLIRLELFSLCTLPSPWVANFKSYKGHHTLLFGDSYFTSIIGPNGSGKSNSDKRLMQRGSMDAISFVLGIKSS
HLRSAQLKDLVYRGRVLKTSKINDDGSAEANGGANGLSDNDARASRGDPKTAWVMAVYEDDAGEEQRWKRSITNQ
GASEYRINERIVTAQQYNEALESENILIKARNFLVFQGDVEAIASQSPQDLTRLIEQISGSLEHKAGYERLQLDA
EQAFENQNFQLHRRRGINSEIKQYREQKKEADNFQKKTEERDAAIIAHCLWKLYHFQKVMDESSSAIQAHQEDLK
ELRRSLETLELRLEAARKEHVFTGRLVAGTEKRIKINKKSIEDGENALVPVNEKILETSHEIEKLEAQSQKIAKE
LDDQAGVVEKVQRDIESVDKAHETFESDIMEQMKEQGRDISEADRKEYNVLRAQVMSRCSSNQSKLENLERQRKA
DEITVNNLKGKIDTIQGAIRKIEAELASTAERLHSGKNLVKGISGDIAEKKKEFNQLQSERVRTNQKRTELEEKL
EDVARKLREADDGRRQSDREIRMRDMMISLKRVFPGVRGRIGELCTPKQKKYDEAVIVALGRDFDSVVVDTERIG
VDCVQFLKEQRFPPTTFIPLDNIKVNAVNTAIKGFAGARLTIDTVNFDLSVERAVSYACGSSVVCDTLDIAKHIC
YDKKLGVKAVTLEGYIIHKAGLMTGGRGPEPKGGKRKFEEADVQNLQRMAETLRDEIDRLPKAGRRGNHEESLQI
ELAGLEQRLAATREEVAALTKNWASKNRELDSFMKQLRERQPKYEEQASQLESTAQTVQEFRNAIAQVEDAVFAD
FCKRLGYSDIRAYEASQGKFEQEVFEKRGQFEVHKQRLEQRLNWEVARHSDTETRIRRAQEKTRRLKHDAKVYID
DKSEIEEALSTKRDELQAMRDTLDEHRTELARKNQKVSEARAEVQKRGRGIEALQRDISALETTVQKNSATKSAL
LRRCRLEQIQIPLKEGTLDNLPTEDDLLRQDPDSMDMDEDDEEMMGIALDDHGIEIDFECLEEELKESDDPSIED
SLTQKITKLTTELEKLNPNMRAMDRLESVESRLKQTDQEYEDSKAAAQAAREAFNSVKQQRYDLFNKAFSHISEQ
ISHVYRDLTRSEAYPLGGQAYLDIEEDTDMPYLSGIKYHAMPPLKRFRDMEHLSGGEKTMAALALLFAIHSYQPS
PFFVLDEVDAALDNANVDKIKKYIREHSGPGMQFIVISLKTGLFQDSESLVGVYRDQDVNSSRTLTLDLRRYA
Coding >Ophio5|7984
ATGGGTAAACTCATTCGCCTCGAGCTCTTCAGTTTGTGCACCCTTCCCAGTCCCTGGGTCGCAAATTTCAAGTCG
TACAAGGGTCATCACACCTTGCTGTTCGGTGACTCGTACTTTACTTCTATCATCGGTCCTAATGGATCGGGCAAG
TCGAATTCCGACAAGCGGCTAATGCAACGAGGTAGCATGGACGCCATCTCCTTCGTCCTCGGCATAAAATCGTCC
CACTTACGCTCTGCTCAACTGAAAGATCTCGTCTACCGTGGACGCGTTCTCAAAACATCCAAAATAAATGACGAT
GGGTCCGCCGAGGCCAATGGTGGCGCGAATGGGCTGTCGGATAACGACGCGAGGGCTTCGCGTGGTGATCCGAAA
ACGGCGTGGGTAATGGCAGTCTACGAAGACGATGCTGGTGAAGAACAGAGATGGAAGCGATCAATCACAAACCAG
GGCGCTAGCGAGTATCGAATCAATGAACGCATTGTCACTGCCCAGCAATACAATGAAGCTCTCGAGTCGGAAAAC
ATTTTGATCAAAGCTCGCAATTTCCTCGTCTTTCAAGGTGACGTCGAGGCTATTGCATCGCAGTCTCCTCAGGAC
CTCACACGCCTAATTGAACAAATATCCGGGAGCCTAGAGCACAAGGCTGGATATGAAAGGCTACAGCTTGACGCA
GAGCAGGCCTTCGAGAATCAGAACTTTCAACTCCACAGGCGGCGTGGAATTAATTCGGAGATCAAGCAGTACCGC
GAGCAAAAGAAGGAGGCCGACAACTTCCAGAAGAAAACAGAGGAACGGGACGCCGCCATCATTGCTCACTGCCTG
TGGAAGCTCTACCACTTTCAAAAGGTGATGGATGAGTCGAGTTCTGCAATCCAGGCTCATCAGGAAGACCTGAAA
GAGCTACGTCGCAGCCTTGAGACTTTGGAATTGCGCCTGGAAGCAGCGCGAAAAGAGCATGTCTTCACTGGACGC
CTCGTCGCCGGGACTGAAAAGCGGATCAAGATCAACAAGAAAAGCATAGAAGATGGCGAAAATGCACTGGTTCCG
GTGAACGAGAAAATCTTAGAAACTTCCCATGAAATCGAGAAACTGGAAGCTCAGAGCCAAAAGATCGCTAAGGAA
CTTGACGACCAGGCTGGCGTGGTGGAAAAAGTCCAGAGGGACATTGAAAGCGTTGACAAGGCCCATGAGACTTTT
GAGTCCGACATCATGGAGCAGATGAAGGAGCAGGGCCGAGACATTAGCGAAGCCGACCGAAAAGAGTACAATGTC
CTGCGAGCGCAAGTCATGTCGCGTTGCAGCAGTAATCAATCAAAGCTCGAAAACCTCGAACGACAGCGCAAGGCC
GATGAGATTACCGTCAATAATCTCAAGGGCAAGATTGATACGATTCAGGGCGCCATTCGGAAGATCGAGGCTGAG
TTGGCAAGCACGGCAGAACGACTACATTCTGGGAAAAATCTTGTCAAGGGAATATCTGGTGACATCGCCGAAAAA
AAAAAGGAATTCAATCAACTTCAGTCAGAGCGGGTACGGACGAACCAAAAGCGGACGGAGCTGGAGGAGAAGTTA
GAAGATGTGGCTCGGAAACTTCGAGAGGCAGACGATGGCCGACGCCAAAGTGATCGCGAGATACGCATGAGGGAC
ATGATGATTTCTCTGAAACGGGTTTTCCCCGGCGTGCGTGGCCGTATCGGCGAGTTGTGTACGCCAAAACAGAAG
AAGTACGACGAAGCAGTCATCGTCGCCCTGGGGAGGGATTTCGACTCGGTCGTGGTCGACACCGAGAGGATCGGA
GTTGACTGTGTCCAATTCTTGAAGGAACAAAGGTTTCCGCCCACGACCTTCATCCCCCTGGATAATATCAAAGTC
AATGCGGTCAATACGGCCATCAAGGGGTTTGCTGGAGCCAGGCTGACCATCGACACGGTCAACTTTGATCTTTCC
GTGGAGAGAGCCGTGTCGTACGCATGCGGCAGTTCGGTCGTCTGTGACACGCTGGACATCGCGAAACATATTTGT
TACGACAAGAAACTGGGCGTGAAAGCAGTGACGCTGGAGGGATACATCATCCACAAGGCGGGACTCATGACCGGC
GGGCGAGGTCCGGAACCCAAAGGAGGAAAGCGCAAGTTCGAAGAGGCCGATGTTCAAAACCTGCAGCGCATGGCC
GAGACATTGCGAGACGAGATAGATCGACTTCCAAAGGCGGGTAGGCGCGGTAACCACGAGGAGTCGCTCCAGATC
GAATTGGCCGGGCTTGAGCAGCGACTCGCGGCGACGAGGGAAGAAGTTGCAGCATTGACCAAGAATTGGGCAAGC
AAGAACCGCGAACTTGACAGCTTCATGAAGCAGCTGCGCGAGCGGCAGCCAAAGTACGAAGAACAAGCCTCACAG
CTCGAGAGCACGGCACAGACCGTGCAGGAGTTCAGAAACGCGATTGCTCAAGTCGAAGACGCGGTCTTCGCCGAC
TTCTGCAAACGACTCGGCTATAGCGACATTCGGGCTTATGAGGCTTCTCAAGGTAAATTCGAACAGGAAGTCTTT
GAGAAGCGGGGCCAGTTCGAAGTTCACAAGCAAAGACTTGAGCAACGTCTGAATTGGGAAGTCGCTCGCCACAGC
GACACAGAGACACGGATCAGGCGAGCGCAGGAGAAGACGCGACGACTGAAGCATGATGCCAAGGTTTACATAGAC
GACAAGTCGGAGATTGAAGAGGCGTTAAGCACGAAACGAGATGAATTGCAGGCCATGCGCGACACTTTGGACGAG
CACAGGACGGAGCTAGCTAGGAAGAACCAGAAGGTCAGCGAAGCTCGAGCCGAGGTACAGAAGCGTGGCAGGGGC
ATCGAGGCTCTCCAGCGCGACATCAGTGCGCTGGAGACGACGGTCCAGAAAAATAGCGCTACGAAGTCGGCCTTG
CTTCGGAGATGCCGATTAGAGCAGATACAGATTCCGCTGAAAGAGGGAACGCTCGATAACCTCCCCACTGAGGAC
GACCTGCTGCGGCAGGATCCGGACTCCATGGATATGGACGAAGATGACGAGGAGATGATGGGCATCGCCCTTGAC
GATCACGGGATCGAGATTGATTTCGAATGCCTGGAGGAAGAGCTGAAAGAGTCTGACGACCCAAGTATAGAGGAC
AGCTTGACGCAGAAAATTACGAAACTCACTACGGAGCTGGAGAAACTGAACCCAAATATGCGTGCCATGGATCGC
CTGGAAAGCGTTGAGTCGAGGCTCAAACAGACGGATCAGGAATACGAAGACTCCAAAGCAGCAGCGCAGGCTGCG
AGGGAAGCCTTCAATAGCGTGAAACAGCAGCGATATGACCTTTTCAACAAAGCGTTCAGCCACATTTCGGAGCAA
ATCTCGCATGTTTACAGAGATCTTACCCGCTCAGAGGCATACCCCCTGGGGGGTCAAGCGTACCTAGATATCGAG
GAAGACACCGATATGCCCTATCTTTCGGGCATCAAATACCACGCCATGCCACCACTCAAGCGGTTTCGGGACATG
GAGCACTTATCGGGGGGGGAAAAGACAATGGCTGCGCTTGCTCTCCTGTTCGCAATTCACAGTTACCAGCCGAGC
CCCTTCTTCGTGCTGGACGAGGTTGACGCTGCGCTCGATAATGCCAATGTCGACAAGATCAAAAAGTACATACGA
GAGCACTCCGGCCCAGGTATGCAGTTTATCGTCATCAGCCTCAAGACCGGTCTGTTTCAGGACTCGGAAAGCCTT
GTCGGTGTCTATCGAGATCAGGATGTCAACAGCTCGAGGACACTTACGTTGGATTTGAGGAGATACGCG
Transcript >Ophio5|7984
ATGGGTAAACTCATTCGCCTCGAGCTCTTCAGTTTGTGCACCCTTCCCAGTCCCTGGGTCGCAAATTTCAAGTCG
TACAAGGGTCATCACACCTTGCTGTTCGGTGACTCGTACTTTACTTCTATCATCGGTCCTAATGGATCGGGCAAG
TCGAATTCCGACAAGCGGCTAATGCAACGAGGTAGCATGGACGCCATCTCCTTCGTCCTCGGCATAAAATCGTCC
CACTTACGCTCTGCTCAACTGAAAGATCTCGTCTACCGTGGACGCGTTCTCAAAACATCCAAAATAAATGACGAT
GGGTCCGCCGAGGCCAATGGTGGCGCGAATGGGCTGTCGGATAACGACGCGAGGGCTTCGCGTGGTGATCCGAAA
ACGGCGTGGGTAATGGCAGTCTACGAAGACGATGCTGGTGAAGAACAGAGATGGAAGCGATCAATCACAAACCAG
GGCGCTAGCGAGTATCGAATCAATGAACGCATTGTCACTGCCCAGCAATACAATGAAGCTCTCGAGTCGGAAAAC
ATTTTGATCAAAGCTCGCAATTTCCTCGTCTTTCAAGGTGACGTCGAGGCTATTGCATCGCAGTCTCCTCAGGAC
CTCACACGCCTAATTGAACAAATATCCGGGAGCCTAGAGCACAAGGCTGGATATGAAAGGCTACAGCTTGACGCA
GAGCAGGCCTTCGAGAATCAGAACTTTCAACTCCACAGGCGGCGTGGAATTAATTCGGAGATCAAGCAGTACCGC
GAGCAAAAGAAGGAGGCCGACAACTTCCAGAAGAAAACAGAGGAACGGGACGCCGCCATCATTGCTCACTGCCTG
TGGAAGCTCTACCACTTTCAAAAGGTGATGGATGAGTCGAGTTCTGCAATCCAGGCTCATCAGGAAGACCTGAAA
GAGCTACGTCGCAGCCTTGAGACTTTGGAATTGCGCCTGGAAGCAGCGCGAAAAGAGCATGTCTTCACTGGACGC
CTCGTCGCCGGGACTGAAAAGCGGATCAAGATCAACAAGAAAAGCATAGAAGATGGCGAAAATGCACTGGTTCCG
GTGAACGAGAAAATCTTAGAAACTTCCCATGAAATCGAGAAACTGGAAGCTCAGAGCCAAAAGATCGCTAAGGAA
CTTGACGACCAGGCTGGCGTGGTGGAAAAAGTCCAGAGGGACATTGAAAGCGTTGACAAGGCCCATGAGACTTTT
GAGTCCGACATCATGGAGCAGATGAAGGAGCAGGGCCGAGACATTAGCGAAGCCGACCGAAAAGAGTACAATGTC
CTGCGAGCGCAAGTCATGTCGCGTTGCAGCAGTAATCAATCAAAGCTCGAAAACCTCGAACGACAGCGCAAGGCC
GATGAGATTACCGTCAATAATCTCAAGGGCAAGATTGATACGATTCAGGGCGCCATTCGGAAGATCGAGGCTGAG
TTGGCAAGCACGGCAGAACGACTACATTCTGGGAAAAATCTTGTCAAGGGAATATCTGGTGACATCGCCGAAAAA
AAAAAGGAATTCAATCAACTTCAGTCAGAGCGGGTACGGACGAACCAAAAGCGGACGGAGCTGGAGGAGAAGTTA
GAAGATGTGGCTCGGAAACTTCGAGAGGCAGACGATGGCCGACGCCAAAGTGATCGCGAGATACGCATGAGGGAC
ATGATGATTTCTCTGAAACGGGTTTTCCCCGGCGTGCGTGGCCGTATCGGCGAGTTGTGTACGCCAAAACAGAAG
AAGTACGACGAAGCAGTCATCGTCGCCCTGGGGAGGGATTTCGACTCGGTCGTGGTCGACACCGAGAGGATCGGA
GTTGACTGTGTCCAATTCTTGAAGGAACAAAGGTTTCCGCCCACGACCTTCATCCCCCTGGATAATATCAAAGTC
AATGCGGTCAATACGGCCATCAAGGGGTTTGCTGGAGCCAGGCTGACCATCGACACGGTCAACTTTGATCTTTCC
GTGGAGAGAGCCGTGTCGTACGCATGCGGCAGTTCGGTCGTCTGTGACACGCTGGACATCGCGAAACATATTTGT
TACGACAAGAAACTGGGCGTGAAAGCAGTGACGCTGGAGGGATACATCATCCACAAGGCGGGACTCATGACCGGC
GGGCGAGGTCCGGAACCCAAAGGAGGAAAGCGCAAGTTCGAAGAGGCCGATGTTCAAAACCTGCAGCGCATGGCC
GAGACATTGCGAGACGAGATAGATCGACTTCCAAAGGCGGGTAGGCGCGGTAACCACGAGGAGTCGCTCCAGATC
GAATTGGCCGGGCTTGAGCAGCGACTCGCGGCGACGAGGGAAGAAGTTGCAGCATTGACCAAGAATTGGGCAAGC
AAGAACCGCGAACTTGACAGCTTCATGAAGCAGCTGCGCGAGCGGCAGCCAAAGTACGAAGAACAAGCCTCACAG
CTCGAGAGCACGGCACAGACCGTGCAGGAGTTCAGAAACGCGATTGCTCAAGTCGAAGACGCGGTCTTCGCCGAC
TTCTGCAAACGACTCGGCTATAGCGACATTCGGGCTTATGAGGCTTCTCAAGGTAAATTCGAACAGGAAGTCTTT
GAGAAGCGGGGCCAGTTCGAAGTTCACAAGCAAAGACTTGAGCAACGTCTGAATTGGGAAGTCGCTCGCCACAGC
GACACAGAGACACGGATCAGGCGAGCGCAGGAGAAGACGCGACGACTGAAGCATGATGCCAAGGTTTACATAGAC
GACAAGTCGGAGATTGAAGAGGCGTTAAGCACGAAACGAGATGAATTGCAGGCCATGCGCGACACTTTGGACGAG
CACAGGACGGAGCTAGCTAGGAAGAACCAGAAGGTCAGCGAAGCTCGAGCCGAGGTACAGAAGCGTGGCAGGGGC
ATCGAGGCTCTCCAGCGCGACATCAGTGCGCTGGAGACGACGGTCCAGAAAAATAGCGCTACGAAGTCGGCCTTG
CTTCGGAGATGCCGATTAGAGCAGATACAGATTCCGCTGAAAGAGGGAACGCTCGATAACCTCCCCACTGAGGAC
GACCTGCTGCGGCAGGATCCGGACTCCATGGATATGGACGAAGATGACGAGGAGATGATGGGCATCGCCCTTGAC
GATCACGGGATCGAGATTGATTTCGAATGCCTGGAGGAAGAGCTGAAAGAGTCTGACGACCCAAGTATAGAGGAC
AGCTTGACGCAGAAAATTACGAAACTCACTACGGAGCTGGAGAAACTGAACCCAAATATGCGTGCCATGGATCGC
CTGGAAAGCGTTGAGTCGAGGCTCAAACAGACGGATCAGGAATACGAAGACTCCAAAGCAGCAGCGCAGGCTGCG
AGGGAAGCCTTCAATAGCGTGAAACAGCAGCGATATGACCTTTTCAACAAAGCGTTCAGCCACATTTCGGAGCAA
ATCTCGCATGTTTACAGAGATCTTACCCGCTCAGAGGCATACCCCCTGGGGGGTCAAGCGTACCTAGATATCGAG
GAAGACACCGATATGCCCTATCTTTCGGGCATCAAATACCACGCCATGCCACCACTCAAGCGGTTTCGGGACATG
GAGCACTTATCGGGGGGGGAAAAGACAATGGCTGCGCTTGCTCTCCTGTTCGCAATTCACAGTTACCAGCCGAGC
CCCTTCTTCGTGCTGGACGAGGTTGACGCTGCGCTCGATAATGCCAATGTCGACAAGATCAAAAAGTACATACGA
GAGCACTCCGGCCCAGGTATGCAGTTTATCGTCATCAGCCTCAAGACCGGTCTGTTTCAGGACTCGGAAAGCCTT
GTCGGTGTCTATCGAGATCAGGATGTCAACAGCTCGAGGACACTTACGTTGGATTTGAGGAGATACGCGTAA
Gene >Ophio5|7984
ATGGGTAAACTCATTCGCCTCGAGCTCTTCAGTTTGTGCACCCTTCCCAGTCCCTGGGTCGCAAGTCCCTCCGTC
GCGTTCTTCGCGCATCTCTAATGCTCCCATCCAGATTTCAAGTCGTACAAGGGTCATCACACCTTGCTGTTCGGT
GACTCGTACTTTACTTCTATCATCGGTCCTAATGGATCGGGCAAGTCGAATTCGTGAGTCTTGCCCTTCGAAAAA
TATCTAAACACTTCTCGAGCGACAAGCGGCTAATGCAACGAGGTAGCATGGACGCCATCTCCTTCGTCCTCGGCA
TAAAATCGTCCCACTTACGCTCTGCTCAACTGAAAGATCTCGTCTACCGTGGACGCGTTCTCAAAACATCCAAAA
TAAATGACGATGGGTCCGCCGAGGCCAATGGTGGCGCGAATGGGCTGTCGGATAACGACGCGAGGGCTTCGCGTG
GTGATCCGAAAACGGCGTGGGTAATGGCAGTCTACGAAGACGATGCTGGTGAAGAACAGAGATGGAAGCGATCAA
TCACAAACCAGGGCGCTAGCGAGTATCGAATCAATGAACGCATTGTCACTGCCCAGCAATACAATGAAGCTCTCG
AGTCGGAAAACATTTTGATCAAAGCTCGCAATTTCCTCGTCTTTCAAGGTGACGTCGAGGCTATTGCATCGCAGT
CTCCTCAGGACCTCACACGCCTAATTGAACAAATATCCGGGAGCCTAGAGCACAAGGCTGGATATGAAAGGCTAC
AGCTTGACGCAGAGCAGGCCTTCGAGAATCAGAACTTTCAACTCCACAGGCGGCGTGGAATTAATTCGGAGATCA
AGCAGTACCGCGAGCAAAAGAAGGAGGCCGACAACTTCCAGAAGAAAACAGAGGAACGGGACGCCGCCATCATTG
CTCACTGCCTGTGGAAGCTCTACCACTTTCAAAAGGTGATGGATGAGTCGAGTTCTGCAATCCAGGCTCATCAGG
AAGACCTGAAAGAGCTACGTCGCAGCCTTGAGACTTTGGAATTGCGCCTGGAAGCAGCGCGAAAAGAGCATGTCT
TCACTGGACGCCTCGTCGCCGGGACTGAAAAGCGGATCAAGATCAACAAGAAAAGCATAGAAGATGGCGAAAATG
CACTGGTTCCGGTGAACGAGAAAATCTTAGAAACTTCCCATGAAATCGAGAAACTGGAAGCTCAGAGCCAAAAGA
TCGCTAAGGAACTTGACGACCAGGCTGGCGTGGTGGAAAAAGTCCAGAGGGACATTGAAAGCGTTGACAAGGCCC
ATGAGACTTTTGAGTCCGACATCATGGAGCAGATGAAGGAGCAGGGCCGAGACATTAGCGAAGCCGACCGAAAAG
AGTACAATGTCCTGCGAGCGCAAGTCATGTCGCGTTGCAGCAGTAATCAATCAAAGCTCGAAAACCTCGAACGAC
AGCGCAAGGCCGATGAGATTACCGTCAATAATCTCAAGGGCAAGATTGATACGATTCAGGGCGCCATTCGGAAGA
TCGAGGCTGAGTTGGCAAGCACGGCAGAACGACTACATTCTGGGAAAAATCTTGTCAAGGGAATATCTGGTGACA
TCGCCGAAAAAAAAAAGGAATTCAATCAACTTCAGTCAGAGCGGGTACGGACGAACCAAAAGCGGACGGAGCTGG
AGGAGAAGTTAGAAGATGTGGCTCGGAAACTTCGAGAGGCAGACGATGGCCGACGCCAAAGTGATCGCGAGATAC
GCATGAGGGACATGATGATTTCTCTGAAACGGGTTTTCCCCGGCGTGCGTGGCCGTATCGGCGAGTTGTGTACGC
CAAAACAGAAGAAGTACGACGAAGCAGTCATCGTCGCCCTGGGGAGGGATTTCGACTCGGTCGTGGTCGACACCG
AGAGGATCGGAGTTGACTGTGTCCAATTCTTGAAGGAACAAAGGTTTCCGCCCACGACCTTCATCCCCCTGGATA
ATATCAAAGTCAATGCGGTCAATACGGCCATCAAGGGGTTTGCTGGAGCCAGGCTGACCATCGACACGGTCAACT
TTGATCTTTCCGTGGAGAGAGCCGTGTCGTACGCATGCGGCAGTTCGGTCGTCTGTGACACGCTGGACATCGCGA
AACATATTTGTTACGACAAGAAACTGGGCGTGAAAGCAGTGACGCTGGAGGGATACATCATCCACAAGGCGGGAC
TCATGACCGGCGGGCGAGGTCCGGAACCCAAAGGAGGAAAGCGCAAGTTCGAAGAGGCCGATGTTCAAAACCTGC
AGCGCATGGCCGAGACATTGCGAGACGAGATAGATCGACTTCCAAAGGCGGGTAGGCGCGGTAACCACGAGGAGT
CGCTCCAGATCGAATTGGCCGGGCTTGAGCAGCGACTCGCGGCGACGAGGGAAGAAGTTGCAGCATTGACCAAGA
ATTGGGCAAGCAAGAACCGCGAACTTGACAGCTTCATGAAGCAGCTGCGCGAGCGGCAGCCAAAGTACGAAGAAC
AAGCCTCACAGCTCGAGAGCACGGCACAGACCGTGCAGGAGTTCAGAAACGCGATTGCTCAAGTCGAAGACGCGG
TCTTCGCCGACTTCTGCAAACGACTCGGCTATAGCGACATTCGGGCTTATGAGGCTTCTCAAGGTAAATTCGAAC
AGGAAGTCTTTGAGAAGCGGGGCCAGTTCGAAGTTCACAAGCAAAGACTTGAGCAACGTCTGAATTGGGAAGTCG
CTCGCCACAGCGACACAGAGACACGGATCAGGCGAGCGCAGGAGAAGACGCGACGACTGAAGCATGATGCCAAGG
TTTACATAGACGACAAGTCGGAGATTGAAGAGGCGTTAAGCACGAAACGAGATGAATTGCAGGCCATGCGCGACA
CTTTGGACGAGCACAGGACGGAGCTAGCTAGGAAGAACCAGAAGGTCAGCGAAGCTCGAGCCGAGGTACAGAAGC
GTGGCAGGGGCATCGAGGCTCTCCAGCGCGACATCAGTGCGCTGGAGACGACGGTCCAGAAAAATAGCGCTACGA
AGTCGGCCTTGCTTCGGAGATGCCGATTAGAGCAGATACAGATTCCGCTGAAAGAGGGAACGCTCGATAACCTCC
CCACTGAGGACGACCTGCTGCGGCAGGATCCGGACTCCATGGATATGGACGAAGATGACGAGGAGATGATGGGCA
TCGCCCTTGACGATCACGGGATCGAGATTGATTTCGAATGCCTGGAGGAAGAGCTGAAAGAGGTCAGCATGACGA
CCCCCTAATGCAGCTGCTGCTAACAGGTAACTAGTCTGACGACCCAAGTATAGAGGACAGCTTGACGCAGAAAAT
TACGAAACTCACTACGGAGCTGGAGAAACTGAACCCAAATATGCGTGCCATGGATCGCCTGGAAAGCGTTGAGTC
GAGGCTCAAACAGACGGATCAGGAATACGAAGACTCCAAAGCAGCAGCGCAGGCTGCGAGGGAAGCCTTCAATAG
CGTGAAACAGCAGCGATATGACCTTTTCAACAAAGCGTTCAGCCACATTTCGGAGCAAATCTCGCATGTTTACAG
AGATCTTACCCGCTCAGAGGCATACCCCCTGGGGGGTCAAGCGTACCTAGATATCGAGGAAGACACCGATATGCC
CTATCTTTCGGGCATCAAATACCACGCCATGCCACCACTCAAGCGGTTTCGGGACATGGAGCACTTATCGGGGGG
GGAAAAGACAATGGCTGCGCTTGCTCTCCTGTTCGCAATTCACAGTTACCAGCCGAGCCCCTTCTTCGTGCTGGA
CGAGGTTGACGCTGCGCTCGATAATGCCAATGTCGACAAGATCAAAAAGTACATACGAGAGCACTCCGGCCCAGG
TATGCAGTTTATCGTCATCAGCCTCAAGACCGGTCTGTTTCAGGACTCGGAAAGCCTTGTCGGTGTCTATCGAGA
TCAGGATGTCAACAGCTCGAGGACACTTACGTTGGATGTGAGTCTCTCGGCTGAAATGTCTTGAACGTCGCTGAC
GCACTTGTCACAGTTGAGGAGATACGCGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail