Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|797
Gene name
Locationscaffold_122:31261..31652
Strand-
Gene length (bp)391
Transcript length (bp)330
Coding sequence length (bp)327
Protein length (aa) 109

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01423 LSM LSM domain 1.1E-10 9 96

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A4IGZ4|LSMD1_XENTR N-alpha-acetyltransferase 38, NatC auxiliary subunit OS=Xenopus tropicalis GN=naa38 PE=3 SV=2 4 99 9.0E-16
sp|Q6GQ67|LMD1A_XENLA N-alpha-acetyltransferase 38-A, NatC auxiliary subunit OS=Xenopus laevis GN=naa38-a PE=3 SV=1 4 99 1.0E-15
sp|Q6NU60|LMD1B_XENLA N-alpha-acetyltransferase 38-B, NatC auxiliary subunit OS=Xenopus laevis GN=naa38-b PE=3 SV=1 4 99 1.0E-14
sp|Q9BRA0|LSMD1_HUMAN N-alpha-acetyltransferase 38, NatC auxiliary subunit OS=Homo sapiens GN=NAA38 PE=1 SV=1 4 100 2.0E-13
sp|Q9D2U5|LSMD1_MOUSE N-alpha-acetyltransferase 38, NatC auxiliary subunit OS=Mus musculus GN=Naa38 PE=1 SV=1 6 100 3.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A4IGZ4|LSMD1_XENTR N-alpha-acetyltransferase 38, NatC auxiliary subunit OS=Xenopus tropicalis GN=naa38 PE=3 SV=2 4 99 9.0E-16
sp|Q6GQ67|LMD1A_XENLA N-alpha-acetyltransferase 38-A, NatC auxiliary subunit OS=Xenopus laevis GN=naa38-a PE=3 SV=1 4 99 1.0E-15
sp|Q6NU60|LMD1B_XENLA N-alpha-acetyltransferase 38-B, NatC auxiliary subunit OS=Xenopus laevis GN=naa38-b PE=3 SV=1 4 99 1.0E-14
sp|Q9BRA0|LSMD1_HUMAN N-alpha-acetyltransferase 38, NatC auxiliary subunit OS=Homo sapiens GN=NAA38 PE=1 SV=1 4 100 2.0E-13
sp|Q9D2U5|LSMD1_MOUSE N-alpha-acetyltransferase 38, NatC auxiliary subunit OS=Mus musculus GN=Naa38 PE=1 SV=1 6 100 3.0E-13
sp|A2BIG9|LSMD1_DANRE N-alpha-acetyltransferase 38, NatC auxiliary subunit OS=Danio rerio GN=naa38 PE=3 SV=1 6 99 4.0E-12
sp|P91918|RSMB_CAEEL Probable small nuclear ribonucleoprotein-associated protein B OS=Caenorhabditis elegans GN=snr-2 PE=3 SV=1 14 99 3.0E-08
sp|Q10163|RSMB_SCHPO Small nuclear ribonucleoprotein-associated protein B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=smb1 PE=1 SV=1 12 99 1.0E-07
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4687 0.8576 0.0659 0.0444 0.2339 0.0009 0.0195 0.0974 0.0317 0.0052

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1902
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2759
Ophiocordyceps australis map64 (Brazil) OphauB2|4422
Ophiocordyceps camponoti-floridani Ophcf2|03375
Ophiocordyceps camponoti-rufipedis Ophun1|579
Ophiocordyceps kimflemingae Ophio5|797 (this protein)
Ophiocordyceps subramaniannii Hirsu2|199

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|797
MDHDEAQAYLKSLLNHNLRITTTDGRLFWGAFKCTDANQNVVLSHTYEYRQPRAAHRSASSDPASALPVEPPVRM
DVPAARYLGLVVVPGHHIVRMELEQFVSQMGKTR
Coding >Ophio5|797
ATGGACCACGACGAGGCACAAGCCTACCTCAAGTCCCTCCTAAACCACAACCTGCGTATCACCACCACCGACGGG
CGCCTCTTCTGGGGCGCCTTCAAATGCACCGACGCCAACCAAAATGTCGTCTTGTCTCACACGTACGAGTACCGA
CAGCCGCGCGCCGCCCATCGCTCAGCCTCCTCCGATCCGGCATCCGCGTTGCCCGTCGAGCCTCCGGTCCGGATG
GACGTCCCGGCCGCGCGATACCTTGGCCTCGTCGTTGTCCCGGGTCATCATATCGTCCGGATGGAGCTCGAGCAG
TTTGTAAGCCAGATGGGGAAGACGCGA
Transcript >Ophio5|797
ATGGACCACGACGAGGCACAAGCCTACCTCAAGTCCCTCCTAAACCACAACCTGCGTATCACCACCACCGACGGG
CGCCTCTTCTGGGGCGCCTTCAAATGCACCGACGCCAACCAAAATGTCGTCTTGTCTCACACGTACGAGTACCGA
CAGCCGCGCGCCGCCCATCGCTCAGCCTCCTCCGATCCGGCATCCGCGTTGCCCGTCGAGCCTCCGGTCCGGATG
GACGTCCCGGCCGCGCGATACCTTGGCCTCGTCGTTGTCCCGGGTCATCATATCGTCCGGATGGAGCTCGAGCAG
TTTGTAAGCCAGATGGGGAAGACGCGATGA
Gene >Ophio5|797
ATGGACCACGACGAGGCACAAGCCTACCTCAAGTCCCTCCTAAACCACAACCTGCGTATCACCACCACCGACGGG
CGCCTCTTCTGGGGCGCCTTCAAATGCACCGACGCCGTCCGTTGCCCATCCTCACGTCCGATTCCACGCGTAGCT
TAGCTGATGGGGTTTCGCGCAGAACCAAAATGTCGTCTTGTCTCACACGTACGAGTACCGACAGCCGCGCGCCGC
CCATCGCTCAGCCTCCTCCGATCCGGCATCCGCGTTGCCCGTCGAGCCTCCGGTCCGGATGGACGTCCCGGCCGC
GCGATACCTTGGCCTCGTCGTTGTCCCGGGTCATCATATCGTCCGGATGGAGCTCGAGCAGTTTGTAAGCCAGAT
GGGGAAGACGCGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail