Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7965
Gene name
Locationscaffold_83:5248..10734
Strand+
Gene length (bp)5486
Transcript length (bp)5298
Coding sequence length (bp)5295
Protein length (aa) 1765

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12906 RINGv RING-variant domain 1.0E-16 143 189

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O60103|DOA10_SCHPO ERAD-associated E3 ubiquitin-protein ligase doa10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=doa10 PE=1 SV=1 840 1748 6.0E-82
sp|O60103|DOA10_SCHPO ERAD-associated E3 ubiquitin-protein ligase doa10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=doa10 PE=1 SV=1 136 257 7.0E-31
sp|F4JKK0|SUD1_ARATH Probable E3 ubiquitin ligase SUD1 OS=Arabidopsis thaliana GN=SUD1 PE=1 SV=1 1116 1314 3.0E-30
sp|F4JKK0|SUD1_ARATH Probable E3 ubiquitin ligase SUD1 OS=Arabidopsis thaliana GN=SUD1 PE=1 SV=1 142 283 2.0E-25
sp|P40318|DOA10_YEAST ERAD-associated E3 ubiquitin-protein ligase DOA10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSM4 PE=1 SV=1 1095 1523 3.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O60103|DOA10_SCHPO ERAD-associated E3 ubiquitin-protein ligase doa10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=doa10 PE=1 SV=1 840 1748 6.0E-82
sp|O60103|DOA10_SCHPO ERAD-associated E3 ubiquitin-protein ligase doa10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=doa10 PE=1 SV=1 136 257 7.0E-31
sp|F4JKK0|SUD1_ARATH Probable E3 ubiquitin ligase SUD1 OS=Arabidopsis thaliana GN=SUD1 PE=1 SV=1 1116 1314 3.0E-30
sp|F4JKK0|SUD1_ARATH Probable E3 ubiquitin ligase SUD1 OS=Arabidopsis thaliana GN=SUD1 PE=1 SV=1 142 283 2.0E-25
sp|P40318|DOA10_YEAST ERAD-associated E3 ubiquitin-protein ligase DOA10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSM4 PE=1 SV=1 1095 1523 3.0E-25
sp|Q5R9W1|MARH6_PONAB E3 ubiquitin-protein ligase MARCH6 OS=Pongo abelii GN=MARCH6 PE=2 SV=1 138 210 2.0E-24
sp|O60337|MARH6_HUMAN E3 ubiquitin-protein ligase MARCH6 OS=Homo sapiens GN=MARCH6 PE=1 SV=2 138 210 2.0E-24
sp|Q6ZQ89|MARH6_MOUSE E3 ubiquitin-protein ligase MARCH6 OS=Mus musculus GN=March6 PE=2 SV=2 138 210 3.0E-24
sp|Q5R9W1|MARH6_PONAB E3 ubiquitin-protein ligase MARCH6 OS=Pongo abelii GN=MARCH6 PE=2 SV=1 1126 1256 4.0E-21
sp|O60337|MARH6_HUMAN E3 ubiquitin-protein ligase MARCH6 OS=Homo sapiens GN=MARCH6 PE=1 SV=2 1126 1256 4.0E-21
sp|Q6ZQ89|MARH6_MOUSE E3 ubiquitin-protein ligase MARCH6 OS=Mus musculus GN=March6 PE=2 SV=2 1126 1256 4.0E-21
sp|P40318|DOA10_YEAST ERAD-associated E3 ubiquitin-protein ligase DOA10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSM4 PE=1 SV=1 123 238 2.0E-16
sp|F4JKK0|SUD1_ARATH Probable E3 ubiquitin ligase SUD1 OS=Arabidopsis thaliana GN=SUD1 PE=1 SV=1 1448 1745 8.0E-14
sp|Q8TCQ1|MARH1_HUMAN E3 ubiquitin-protein ligase MARCH1 OS=Homo sapiens GN=MARCH1 PE=1 SV=1 131 193 3.0E-13
sp|Q6NZQ8|MARH1_MOUSE E3 ubiquitin-protein ligase MARCH1 OS=Mus musculus GN=March1 PE=1 SV=2 131 193 3.0E-13
sp|Q28IK8|MARH8_XENTR E3 ubiquitin-protein ligase MARCH8 OS=Xenopus tropicalis GN=march8 PE=2 SV=1 129 193 2.0E-12
sp|Q0VD59|MARH8_BOVIN E3 ubiquitin-protein ligase MARCH8 OS=Bos taurus GN=MARCH8 PE=2 SV=1 131 193 2.0E-12
sp|Q9DBD2|MARH8_MOUSE E3 ubiquitin-protein ligase MARCH8 OS=Mus musculus GN=March8 PE=2 SV=1 91 193 3.0E-12
sp|Q5XH39|MARH8_XENLA E3 ubiquitin-protein ligase MARCH8 OS=Xenopus laevis GN=march8 PE=2 SV=2 131 193 3.0E-12
sp|Q5T0T0|MARH8_HUMAN E3 ubiquitin-protein ligase MARCH8 OS=Homo sapiens GN=MARCH8 PE=1 SV=1 131 193 4.0E-12
sp|Q68FA7|MARH3_XENTR E3 ubiquitin-protein ligase MARCH3 OS=Xenopus tropicalis GN=march3 PE=2 SV=1 132 239 1.0E-11
sp|Q0IH10|MARH3_XENLA E3 ubiquitin-protein ligase MARCH3 OS=Xenopus laevis GN=march3 PE=2 SV=1 128 239 3.0E-11
sp|Q86UD3|MARH3_HUMAN E3 ubiquitin-protein ligase MARCH3 OS=Homo sapiens GN=MARCH3 PE=2 SV=1 142 239 8.0E-11
sp|Q5PQ35|MARH2_XENLA E3 ubiquitin-protein ligase MARCH2 OS=Xenopus laevis GN=march2 PE=2 SV=1 142 193 2.0E-10
sp|Q28EX7|MARH2_XENTR E3 ubiquitin-protein ligase MARCH2 OS=Xenopus tropicalis GN=march2 PE=2 SV=1 142 193 2.0E-10
sp|Q5I0I2|MARH2_RAT E3 ubiquitin-protein ligase MARCH2 OS=Rattus norvegicus GN=March2 PE=1 SV=1 143 201 3.0E-10
sp|A0JN69|MARH3_BOVIN E3 ubiquitin-protein ligase MARCH3 OS=Bos taurus GN=MARCH3 PE=2 SV=1 142 239 2.0E-09
sp|Q5XIE5|MARH3_RAT E3 ubiquitin-protein ligase MARCH3 OS=Rattus norvegicus GN=March3 PE=1 SV=1 142 239 2.0E-09
sp|Q8BRX9|MARH3_MOUSE E3 ubiquitin-protein ligase MARCH3 OS=Mus musculus GN=March3 PE=2 SV=1 142 239 2.0E-09
sp|Q32L65|MARH2_BOVIN E3 ubiquitin-protein ligase MARCH2 OS=Bos taurus GN=MARCH2 PE=2 SV=1 142 197 3.0E-09
sp|Q1LVZ2|MARH2_DANRE E3 ubiquitin-protein ligase MARCH2 OS=Danio rerio GN=march2 PE=2 SV=1 142 201 4.0E-09
sp|Q9P0N8|MARH2_HUMAN E3 ubiquitin-protein ligase MARCH2 OS=Homo sapiens GN=MARCH2 PE=1 SV=1 142 197 9.0E-09
sp|A6NNE9|MARHB_HUMAN E3 ubiquitin-protein ligase MARCH11 OS=Homo sapiens GN=MARCH11 PE=2 SV=3 119 249 9.0E-09
sp|Q99M02|MARH2_MOUSE E3 ubiquitin-protein ligase MARCH2 OS=Mus musculus GN=March2 PE=2 SV=1 142 197 1.0E-08
sp|Q8CBH7|MARHB_MOUSE E3 ubiquitin-protein ligase MARCH11 OS=Mus musculus GN=March11 PE=2 SV=2 124 250 3.0E-08
sp|A6P320|MARHB_RAT E3 ubiquitin-protein ligase MARCH11 OS=Rattus norvegicus GN=March11 PE=1 SV=1 124 249 3.0E-08
sp|Q5XIV2|MARHA_RAT Probable E3 ubiquitin-protein ligase MARCH10 OS=Rattus norvegicus GN=March10 PE=1 SV=1 143 199 3.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0046914 transition metal ion binding No
GO:0046872 metal ion binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0043167 ion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 225 244 19
2 380 402 22
3 852 874 22
4 917 939 22
5 989 1011 22
6 1016 1038 22
7 1069 1088 19
8 1119 1141 22
9 1161 1183 22
10 1225 1247 22
11 1457 1479 22
12 1499 1521 22
13 1553 1575 22
14 1650 1672 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 42.15 21.72 62.57
CcL In ants, during behavior modification 56.18 27.69 84.66
CcD In ants, recently dead 41.26 21.30 61.23

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.259250 no
SC16a CcD 0.944964 no
CcL CcD 0.223687 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7965
MFLSSQYIFHVLTEPGGFAPPRQRASRCQRQYLPRRPHTKTLLPTVCRFSRPSRLTHPPISEPTADRKYSHTTPY
PFPSDTPIYHRLSNDLSRGLLAIAPVPDDSLIMAETASDHRPPDQTSHHKHGRSRPSAQSLDAAPSICRICRGEG
TAAEPLFYPCKCSGSIKYVHQDCLMEWLSHSQKKYCELCKTSFRFTKLYAPDMPKSLPLHVFVEHMGRYLLRNLL
TWLRAAVTISVWACWLPYFMRSVWSFMFWVSDEGLGGGSFLSRANDTDATTLWLSASVGTCPASPLLATTTTSAT
EAAAVLESLDGEDLSEYLLRILFGSLGMPMKLGRPDLRPHYDIANASLANGVSMPPASLLGNMNFLHNLTRSPTL
NRTVVTVLEGQIITVLVIICFILVILVRDYVVQQQPEINMRAAFEEPGNDLAPEDHDMAQAAVAEPAQQAQRPDS
DDEASDNVDRPAVAPASEAVPGNNDAAGAALVAHAELAGSQRDSSGHLGTDQFHNTPTPAVAVNTNGQGNSSVTD
AARAHLQDSDESDIQKRIDSVYEKAVEEDFKKWDDTGRPSSNNVEEPGRQSDLARLGDPANPSTEAGPSEETDPA
QSSSITAANKSSKNKGKERELTSPGPGFDLQGGPSRKRAASEGPARRRAASDGPFHQPGMNPLGSNNWSFSRLPA
DDPVDGDSVRTPASASAADVEASSLPKDDDLPVTSTSMDEGSHLNGTAQAQPYDDDVREPSRHRGAALEEQNPVD
EAAADGQEAAGLVGRVAHFMWGDLEEPQDGIVENVAGEDADADDEDPWIDVPMAEGADENGDVDLGDVDGVVAGA
GLDAEALDDLEDFEGVMELIGMRGPIAGLFQNAIFCAVLVSVTIFACIFIPYNMGRIAFWVVANPMQLVRILFEF
SKVVQDAVIMLGGLSSWFVLNLLDMFTGLLGGPLAAQIVTVRKASWGLWTGAGTRVMDYALLEFPMSASEMHNFS
AISHEALNTVKGSVASALGALGVCLASILTPSFYAVDRGSLVAAASAIITTLINLKAALSLVLDPGSWVIDLSRT
EARAAIDPGLAYWSSLDRFWAILAGYLTIFAMGAMYLRRGTPFSRNNMVQAWEAGIIDTLHQASGIMKVIVIISI
EMLVFPLYCGLLLDAALLPLFENTTIKSRILFTYNFPLTSIFVHWFVGTGYMFHFALFVSMCRKIMRPGVLYFIR
DPDDPEFHPIRDVLERSLTTQLRKILFSAFVYGALVIVCLGGVVWSLSYTLPGVLPIHYSSNEPVLEFPVDLLFY
NFLMPQAVKVLKPGDGLHAMYTWWFRKCARGLRLTFFLFGERRIDEEGTLQLGVDTAGSFPRHKRLFLELNEHNK
VVPKSWRDTFEVGDAKPNPSLSSREERLLRRKKQHLVASGQLTRSGRFVRAPASDRVNIPKGKPVLLHVTELGRR
KDGKPDNDIYASGQYQMVYIPPNFRVRIFLFILFIWLFAAVTGVGITMAPLALGRKMFKLLIPEHIRTNDIYAFS
IGIYLLGTASYSVLCVQKIMAEVQAWVRKAWIEATRGHALRHAWTGLLRGAKLVYAYTFILIVFPLLSSTLMELY
ITIPLHTYMDPPTAEPAPKQAGEGGRHTIRVIQAWTLGLLYLNLGTRMVKSLFPESRAALAVRIMMRRGWLRPDI
GILTRAFVMPGLALAAVAMFGPPLMASFLIDAEVLGNEVHGAGELAAIYRHSYPAAALVVVVVKQAAGMARVFRG
WRAGIRDEAYLIGERLHNFGITAAGGGRAKRAWGAGRSRL
Coding >Ophio5|7965
ATGTTTCTTTCAAGTCAATACATCTTTCACGTCCTCACGGAGCCGGGTGGCTTCGCACCTCCCCGTCAAAGGGCC
TCACGCTGCCAGCGTCAATATCTGCCTCGACGGCCGCACACAAAAACACTTCTCCCGACAGTCTGCCGCTTCTCT
CGCCCATCTCGACTCACCCACCCGCCCATCTCGGAACCCACTGCCGACCGCAAATACTCACACACGACCCCTTAC
CCCTTCCCGTCCGACACGCCAATCTATCACCGTCTCTCGAATGACTTATCGCGTGGCCTGCTTGCCATAGCACCT
GTTCCCGACGACTCGTTAATCATGGCTGAAACAGCATCCGACCACAGGCCACCCGACCAAACTTCTCACCACAAA
CATGGCCGCTCCAGGCCTTCTGCCCAGTCGCTCGACGCCGCGCCGTCCATCTGTCGAATATGCCGCGGTGAAGGC
ACAGCTGCCGAGCCGCTCTTTTACCCTTGCAAATGCAGCGGCAGCATCAAGTACGTCCATCAGGACTGTCTGATG
GAGTGGCTGTCACACTCCCAGAAGAAGTACTGCGAGCTCTGCAAGACGTCGTTCCGCTTCACCAAGCTCTATGCG
CCCGACATGCCAAAGTCTCTGCCCTTGCACGTCTTTGTCGAGCACATGGGCAGGTACTTGTTGCGGAACCTGCTG
ACATGGTTGCGGGCCGCCGTCACCATCAGCGTCTGGGCATGCTGGCTGCCCTACTTCATGCGCTCCGTCTGGTCC
TTCATGTTCTGGGTCAGTGACGAGGGCCTCGGCGGTGGCTCCTTTCTCTCTCGAGCCAACGACACCGACGCGACT
ACGCTGTGGCTTTCCGCCTCTGTTGGTACATGTCCAGCCAGTCCATTGCTGGCCACAACCACCACTTCTGCAACC
GAGGCGGCTGCCGTGCTCGAGAGCCTCGACGGTGAAGACCTCTCCGAATATCTCTTGCGCATTCTATTCGGCTCG
CTCGGCATGCCCATGAAGCTTGGCCGTCCCGATCTACGACCACATTACGACATTGCCAACGCTTCTTTGGCAAAT
GGCGTCAGCATGCCACCTGCGTCCCTTCTGGGCAACATGAACTTTCTCCATAACCTCACTCGAAGCCCGACGCTG
AACCGGACCGTCGTTACGGTTCTTGAGGGACAAATCATCACTGTTTTGGTCATCATCTGCTTCATACTCGTCATC
TTGGTGCGAGACTATGTGGTCCAGCAGCAGCCTGAAATCAACATGCGAGCCGCCTTTGAGGAGCCAGGAAATGAC
CTTGCTCCCGAAGATCATGACATGGCCCAGGCCGCCGTCGCCGAGCCAGCCCAACAAGCTCAAAGGCCAGACTCC
GACGACGAAGCATCGGATAACGTTGATAGGCCGGCGGTTGCACCGGCATCCGAAGCCGTCCCCGGAAACAACGAT
GCAGCCGGCGCCGCTCTTGTCGCGCACGCCGAGCTAGCCGGTTCGCAACGAGACTCTTCCGGCCATCTCGGCACG
GATCAATTCCACAATACCCCAACTCCGGCTGTGGCAGTCAACACTAATGGCCAGGGTAACAGCAGCGTCACGGAT
GCTGCGCGAGCACATCTGCAAGACAGCGACGAATCTGATATCCAAAAAAGGATAGATTCTGTGTACGAGAAGGCT
GTAGAAGAAGACTTCAAAAAATGGGACGACACGGGGAGGCCGTCTTCGAACAACGTGGAGGAACCCGGCCGACAA
TCTGACTTGGCCAGACTTGGGGATCCTGCGAATCCTTCGACGGAAGCTGGACCTAGCGAAGAGACCGACCCGGCG
CAGTCATCCAGTATCACAGCGGCGAACAAGTCATCCAAGAACAAGGGGAAAGAGCGGGAGCTGACTTCGCCGGGG
CCCGGTTTCGATCTGCAAGGTGGCCCCTCGAGAAAGCGTGCTGCCTCGGAGGGGCCGGCGAGGAGACGTGCTGCT
TCGGACGGGCCTTTCCATCAACCTGGGATGAACCCTTTGGGAAGCAACAATTGGTCCTTTTCCCGCCTACCGGCT
GACGACCCTGTCGACGGCGATTCGGTTCGAACGCCTGCATCTGCCTCAGCAGCCGACGTAGAAGCATCGTCGCTA
CCAAAGGACGACGACCTGCCGGTCACCTCTACGTCGATGGACGAGGGGTCGCACCTCAACGGCACAGCCCAGGCT
CAACCCTACGACGATGATGTCAGAGAGCCGTCGCGTCATCGCGGTGCCGCGCTGGAGGAGCAAAACCCAGTCGAC
GAAGCTGCCGCTGATGGGCAAGAGGCGGCAGGTTTGGTCGGCCGCGTCGCTCATTTCATGTGGGGGGATCTCGAA
GAACCCCAAGACGGAATCGTCGAAAACGTCGCCGGCGAAGACGCCGATGCCGATGACGAGGACCCCTGGATCGAC
GTTCCGATGGCCGAGGGCGCCGACGAGAATGGCGATGTCGACTTAGGGGACGTTGACGGCGTCGTCGCTGGGGCG
GGCTTGGACGCCGAAGCACTTGATGACCTCGAGGACTTTGAGGGTGTCATGGAGCTCATCGGCATGCGCGGGCCC
ATCGCTGGCCTGTTCCAGAACGCCATCTTCTGCGCCGTCCTCGTGTCCGTCACGATCTTTGCCTGCATCTTTATT
CCTTACAACATGGGCCGCATCGCTTTCTGGGTTGTGGCAAACCCGATGCAGCTCGTCCGCATACTCTTCGAGTTT
TCCAAGGTAGTACAGGACGCCGTGATTATGCTGGGCGGCCTTAGCTCGTGGTTCGTCCTCAATCTGCTGGACATG
TTCACTGGTCTGCTCGGTGGGCCGCTGGCCGCCCAGATCGTGACGGTGAGAAAGGCATCGTGGGGGCTTTGGACC
GGGGCCGGGACGAGGGTCATGGATTACGCCCTACTGGAATTCCCCATGTCTGCCTCGGAGATGCACAACTTCTCG
GCCATCAGCCACGAGGCCCTCAACACTGTCAAAGGCTCCGTCGCGTCGGCCCTTGGGGCCCTTGGGGTTTGCCTC
GCGTCCATACTGACACCGAGCTTCTATGCGGTCGACAGGGGGTCCTTGGTTGCAGCGGCCTCGGCTATCATCACG
ACCCTCATCAACCTCAAGGCCGCTCTGTCGCTCGTCCTCGATCCAGGCTCCTGGGTCATCGACCTCAGCAGAACA
GAGGCACGTGCGGCCATCGACCCGGGCCTGGCCTACTGGTCCAGCCTCGACCGCTTCTGGGCCATCCTCGCCGGC
TACCTGACCATCTTCGCAATGGGCGCCATGTATTTGCGGAGAGGTACGCCCTTCTCGAGGAACAACATGGTGCAG
GCGTGGGAGGCCGGCATCATCGACACGCTGCACCAGGCTAGCGGCATCATGAAAGTCATCGTCATCATTAGCATC
GAGATGCTGGTCTTCCCGCTCTACTGCGGGCTTCTGCTCGACGCCGCCCTCCTGCCACTCTTTGAGAACACGACG
ATCAAATCACGAATCCTCTTCACGTACAATTTTCCCCTTACGTCAATCTTCGTCCACTGGTTTGTGGGAACTGGA
TACATGTTTCACTTTGCTCTGTTTGTGTCCATGTGCCGCAAGATTATGCGACCTGGCGTGCTATATTTCATTAGA
GATCCAGATGACCCCGAGTTCCACCCCATTCGCGATGTGTTGGAGAGGAGTCTGACGACGCAGCTGCGAAAGATT
CTCTTCTCCGCCTTTGTATACGGCGCACTCGTCATCGTCTGCCTCGGGGGTGTCGTCTGGAGTCTTTCGTACACG
TTACCCGGAGTGCTACCTATCCACTATTCGTCCAACGAGCCGGTCCTCGAATTCCCCGTCGATCTCCTCTTCTAC
AACTTTCTCATGCCCCAGGCGGTCAAAGTTCTCAAACCAGGCGACGGGCTGCATGCCATGTACACGTGGTGGTTT
CGCAAGTGCGCTCGCGGCCTGCGACTTACCTTTTTCCTCTTTGGAGAACGGCGCATTGACGAGGAGGGAACCCTT
CAACTTGGCGTCGACACGGCGGGCAGCTTTCCCCGCCACAAGAGGCTATTCCTCGAGCTCAACGAGCATAACAAG
GTCGTTCCCAAGTCCTGGCGCGACACGTTCGAGGTCGGTGATGCCAAGCCGAACCCGTCGCTGTCCAGCCGCGAG
GAGAGGCTATTGCGCCGCAAGAAGCAGCACCTAGTAGCCTCGGGCCAGCTCACGCGAAGCGGGCGATTCGTGCGA
GCCCCGGCGTCAGACCGCGTCAATATTCCCAAGGGTAAGCCGGTCTTGCTCCACGTGACGGAGCTGGGCCGGCGC
AAGGACGGCAAGCCAGACAATGACATTTACGCGTCCGGCCAGTACCAGATGGTCTACATCCCGCCAAACTTTCGC
GTCAGGATCTTCCTGTTCATCCTCTTCATCTGGCTGTTCGCGGCGGTGACAGGGGTTGGCATCACCATGGCCCCG
CTGGCGCTGGGCCGGAAGATGTTCAAGCTGCTGATTCCCGAGCACATTCGGACCAACGACATTTACGCCTTTAGC
ATCGGAATATACCTCCTGGGCACTGCAAGCTACTCTGTCCTCTGCGTCCAGAAGATCATGGCCGAGGTCCAGGCA
TGGGTTCGAAAGGCATGGATCGAGGCGACGAGAGGGCACGCTCTCAGACATGCATGGACCGGTCTCTTACGCGGC
GCCAAGTTGGTGTACGCCTACACGTTCATCCTGATCGTGTTTCCGCTCCTGTCGTCTACTCTGATGGAGCTGTAC
ATTACGATTCCGCTGCACACATACATGGATCCCCCGACGGCGGAACCGGCGCCGAAGCAGGCCGGCGAGGGAGGC
CGGCATACGATCCGCGTCATCCAGGCGTGGACCCTGGGGCTTCTGTATCTCAATCTTGGGACGAGGATGGTCAAG
TCCCTGTTCCCCGAGAGTCGAGCGGCGTTGGCGGTGCGCATCATGATGCGGAGGGGATGGTTGCGACCCGACATT
GGCATCCTGACAAGGGCGTTTGTGATGCCCGGACTGGCCTTGGCGGCAGTAGCAATGTTCGGGCCACCGCTGATG
GCGAGTTTCCTGATCGATGCGGAGGTCTTAGGCAACGAAGTCCACGGGGCGGGCGAGCTGGCGGCCATCTACCGA
CACTCGTATCCGGCGGCGGCGCTGGTGGTCGTGGTGGTCAAGCAAGCAGCCGGCATGGCCAGGGTCTTCAGGGGC
TGGAGGGCCGGAATACGCGACGAGGCCTATCTTATCGGGGAGCGGCTACACAATTTTGGCATAACGGCGGCGGGA
GGCGGTAGGGCCAAGCGGGCTTGGGGGGCGGGGAGGTCGAGGCTG
Transcript >Ophio5|7965
ATGTTTCTTTCAAGTCAATACATCTTTCACGTCCTCACGGAGCCGGGTGGCTTCGCACCTCCCCGTCAAAGGGCC
TCACGCTGCCAGCGTCAATATCTGCCTCGACGGCCGCACACAAAAACACTTCTCCCGACAGTCTGCCGCTTCTCT
CGCCCATCTCGACTCACCCACCCGCCCATCTCGGAACCCACTGCCGACCGCAAATACTCACACACGACCCCTTAC
CCCTTCCCGTCCGACACGCCAATCTATCACCGTCTCTCGAATGACTTATCGCGTGGCCTGCTTGCCATAGCACCT
GTTCCCGACGACTCGTTAATCATGGCTGAAACAGCATCCGACCACAGGCCACCCGACCAAACTTCTCACCACAAA
CATGGCCGCTCCAGGCCTTCTGCCCAGTCGCTCGACGCCGCGCCGTCCATCTGTCGAATATGCCGCGGTGAAGGC
ACAGCTGCCGAGCCGCTCTTTTACCCTTGCAAATGCAGCGGCAGCATCAAGTACGTCCATCAGGACTGTCTGATG
GAGTGGCTGTCACACTCCCAGAAGAAGTACTGCGAGCTCTGCAAGACGTCGTTCCGCTTCACCAAGCTCTATGCG
CCCGACATGCCAAAGTCTCTGCCCTTGCACGTCTTTGTCGAGCACATGGGCAGGTACTTGTTGCGGAACCTGCTG
ACATGGTTGCGGGCCGCCGTCACCATCAGCGTCTGGGCATGCTGGCTGCCCTACTTCATGCGCTCCGTCTGGTCC
TTCATGTTCTGGGTCAGTGACGAGGGCCTCGGCGGTGGCTCCTTTCTCTCTCGAGCCAACGACACCGACGCGACT
ACGCTGTGGCTTTCCGCCTCTGTTGGTACATGTCCAGCCAGTCCATTGCTGGCCACAACCACCACTTCTGCAACC
GAGGCGGCTGCCGTGCTCGAGAGCCTCGACGGTGAAGACCTCTCCGAATATCTCTTGCGCATTCTATTCGGCTCG
CTCGGCATGCCCATGAAGCTTGGCCGTCCCGATCTACGACCACATTACGACATTGCCAACGCTTCTTTGGCAAAT
GGCGTCAGCATGCCACCTGCGTCCCTTCTGGGCAACATGAACTTTCTCCATAACCTCACTCGAAGCCCGACGCTG
AACCGGACCGTCGTTACGGTTCTTGAGGGACAAATCATCACTGTTTTGGTCATCATCTGCTTCATACTCGTCATC
TTGGTGCGAGACTATGTGGTCCAGCAGCAGCCTGAAATCAACATGCGAGCCGCCTTTGAGGAGCCAGGAAATGAC
CTTGCTCCCGAAGATCATGACATGGCCCAGGCCGCCGTCGCCGAGCCAGCCCAACAAGCTCAAAGGCCAGACTCC
GACGACGAAGCATCGGATAACGTTGATAGGCCGGCGGTTGCACCGGCATCCGAAGCCGTCCCCGGAAACAACGAT
GCAGCCGGCGCCGCTCTTGTCGCGCACGCCGAGCTAGCCGGTTCGCAACGAGACTCTTCCGGCCATCTCGGCACG
GATCAATTCCACAATACCCCAACTCCGGCTGTGGCAGTCAACACTAATGGCCAGGGTAACAGCAGCGTCACGGAT
GCTGCGCGAGCACATCTGCAAGACAGCGACGAATCTGATATCCAAAAAAGGATAGATTCTGTGTACGAGAAGGCT
GTAGAAGAAGACTTCAAAAAATGGGACGACACGGGGAGGCCGTCTTCGAACAACGTGGAGGAACCCGGCCGACAA
TCTGACTTGGCCAGACTTGGGGATCCTGCGAATCCTTCGACGGAAGCTGGACCTAGCGAAGAGACCGACCCGGCG
CAGTCATCCAGTATCACAGCGGCGAACAAGTCATCCAAGAACAAGGGGAAAGAGCGGGAGCTGACTTCGCCGGGG
CCCGGTTTCGATCTGCAAGGTGGCCCCTCGAGAAAGCGTGCTGCCTCGGAGGGGCCGGCGAGGAGACGTGCTGCT
TCGGACGGGCCTTTCCATCAACCTGGGATGAACCCTTTGGGAAGCAACAATTGGTCCTTTTCCCGCCTACCGGCT
GACGACCCTGTCGACGGCGATTCGGTTCGAACGCCTGCATCTGCCTCAGCAGCCGACGTAGAAGCATCGTCGCTA
CCAAAGGACGACGACCTGCCGGTCACCTCTACGTCGATGGACGAGGGGTCGCACCTCAACGGCACAGCCCAGGCT
CAACCCTACGACGATGATGTCAGAGAGCCGTCGCGTCATCGCGGTGCCGCGCTGGAGGAGCAAAACCCAGTCGAC
GAAGCTGCCGCTGATGGGCAAGAGGCGGCAGGTTTGGTCGGCCGCGTCGCTCATTTCATGTGGGGGGATCTCGAA
GAACCCCAAGACGGAATCGTCGAAAACGTCGCCGGCGAAGACGCCGATGCCGATGACGAGGACCCCTGGATCGAC
GTTCCGATGGCCGAGGGCGCCGACGAGAATGGCGATGTCGACTTAGGGGACGTTGACGGCGTCGTCGCTGGGGCG
GGCTTGGACGCCGAAGCACTTGATGACCTCGAGGACTTTGAGGGTGTCATGGAGCTCATCGGCATGCGCGGGCCC
ATCGCTGGCCTGTTCCAGAACGCCATCTTCTGCGCCGTCCTCGTGTCCGTCACGATCTTTGCCTGCATCTTTATT
CCTTACAACATGGGCCGCATCGCTTTCTGGGTTGTGGCAAACCCGATGCAGCTCGTCCGCATACTCTTCGAGTTT
TCCAAGGTAGTACAGGACGCCGTGATTATGCTGGGCGGCCTTAGCTCGTGGTTCGTCCTCAATCTGCTGGACATG
TTCACTGGTCTGCTCGGTGGGCCGCTGGCCGCCCAGATCGTGACGGTGAGAAAGGCATCGTGGGGGCTTTGGACC
GGGGCCGGGACGAGGGTCATGGATTACGCCCTACTGGAATTCCCCATGTCTGCCTCGGAGATGCACAACTTCTCG
GCCATCAGCCACGAGGCCCTCAACACTGTCAAAGGCTCCGTCGCGTCGGCCCTTGGGGCCCTTGGGGTTTGCCTC
GCGTCCATACTGACACCGAGCTTCTATGCGGTCGACAGGGGGTCCTTGGTTGCAGCGGCCTCGGCTATCATCACG
ACCCTCATCAACCTCAAGGCCGCTCTGTCGCTCGTCCTCGATCCAGGCTCCTGGGTCATCGACCTCAGCAGAACA
GAGGCACGTGCGGCCATCGACCCGGGCCTGGCCTACTGGTCCAGCCTCGACCGCTTCTGGGCCATCCTCGCCGGC
TACCTGACCATCTTCGCAATGGGCGCCATGTATTTGCGGAGAGGTACGCCCTTCTCGAGGAACAACATGGTGCAG
GCGTGGGAGGCCGGCATCATCGACACGCTGCACCAGGCTAGCGGCATCATGAAAGTCATCGTCATCATTAGCATC
GAGATGCTGGTCTTCCCGCTCTACTGCGGGCTTCTGCTCGACGCCGCCCTCCTGCCACTCTTTGAGAACACGACG
ATCAAATCACGAATCCTCTTCACGTACAATTTTCCCCTTACGTCAATCTTCGTCCACTGGTTTGTGGGAACTGGA
TACATGTTTCACTTTGCTCTGTTTGTGTCCATGTGCCGCAAGATTATGCGACCTGGCGTGCTATATTTCATTAGA
GATCCAGATGACCCCGAGTTCCACCCCATTCGCGATGTGTTGGAGAGGAGTCTGACGACGCAGCTGCGAAAGATT
CTCTTCTCCGCCTTTGTATACGGCGCACTCGTCATCGTCTGCCTCGGGGGTGTCGTCTGGAGTCTTTCGTACACG
TTACCCGGAGTGCTACCTATCCACTATTCGTCCAACGAGCCGGTCCTCGAATTCCCCGTCGATCTCCTCTTCTAC
AACTTTCTCATGCCCCAGGCGGTCAAAGTTCTCAAACCAGGCGACGGGCTGCATGCCATGTACACGTGGTGGTTT
CGCAAGTGCGCTCGCGGCCTGCGACTTACCTTTTTCCTCTTTGGAGAACGGCGCATTGACGAGGAGGGAACCCTT
CAACTTGGCGTCGACACGGCGGGCAGCTTTCCCCGCCACAAGAGGCTATTCCTCGAGCTCAACGAGCATAACAAG
GTCGTTCCCAAGTCCTGGCGCGACACGTTCGAGGTCGGTGATGCCAAGCCGAACCCGTCGCTGTCCAGCCGCGAG
GAGAGGCTATTGCGCCGCAAGAAGCAGCACCTAGTAGCCTCGGGCCAGCTCACGCGAAGCGGGCGATTCGTGCGA
GCCCCGGCGTCAGACCGCGTCAATATTCCCAAGGGTAAGCCGGTCTTGCTCCACGTGACGGAGCTGGGCCGGCGC
AAGGACGGCAAGCCAGACAATGACATTTACGCGTCCGGCCAGTACCAGATGGTCTACATCCCGCCAAACTTTCGC
GTCAGGATCTTCCTGTTCATCCTCTTCATCTGGCTGTTCGCGGCGGTGACAGGGGTTGGCATCACCATGGCCCCG
CTGGCGCTGGGCCGGAAGATGTTCAAGCTGCTGATTCCCGAGCACATTCGGACCAACGACATTTACGCCTTTAGC
ATCGGAATATACCTCCTGGGCACTGCAAGCTACTCTGTCCTCTGCGTCCAGAAGATCATGGCCGAGGTCCAGGCA
TGGGTTCGAAAGGCATGGATCGAGGCGACGAGAGGGCACGCTCTCAGACATGCATGGACCGGTCTCTTACGCGGC
GCCAAGTTGGTGTACGCCTACACGTTCATCCTGATCGTGTTTCCGCTCCTGTCGTCTACTCTGATGGAGCTGTAC
ATTACGATTCCGCTGCACACATACATGGATCCCCCGACGGCGGAACCGGCGCCGAAGCAGGCCGGCGAGGGAGGC
CGGCATACGATCCGCGTCATCCAGGCGTGGACCCTGGGGCTTCTGTATCTCAATCTTGGGACGAGGATGGTCAAG
TCCCTGTTCCCCGAGAGTCGAGCGGCGTTGGCGGTGCGCATCATGATGCGGAGGGGATGGTTGCGACCCGACATT
GGCATCCTGACAAGGGCGTTTGTGATGCCCGGACTGGCCTTGGCGGCAGTAGCAATGTTCGGGCCACCGCTGATG
GCGAGTTTCCTGATCGATGCGGAGGTCTTAGGCAACGAAGTCCACGGGGCGGGCGAGCTGGCGGCCATCTACCGA
CACTCGTATCCGGCGGCGGCGCTGGTGGTCGTGGTGGTCAAGCAAGCAGCCGGCATGGCCAGGGTCTTCAGGGGC
TGGAGGGCCGGAATACGCGACGAGGCCTATCTTATCGGGGAGCGGCTACACAATTTTGGCATAACGGCGGCGGGA
GGCGGTAGGGCCAAGCGGGCTTGGGGGGCGGGGAGGTCGAGGCTGTGA
Gene >Ophio5|7965
ATGTTTCTTTCAAGGTTTTAAAGTTTGCTATCCGCCCCTTTTTCCCAGTATCCACTATCTGATATACCTCAGTCA
ATACATCTTTCACGTCCTCACGGAGCCGGGTGGCTTCGCACCTCCCCGTCAAAGGGCCTCACGCTGCCAGCGTCA
ATATCTGCCTCGGTAAGTAGGGAGCCATCTTCACCCACCCATGGCTTCACACATTGGCTTCCTCTAATCCACAAA
GTTGAAATCTAGACGGCCGCACACAAAAACACTTCTCCCGACAGTCTGCCGCTTCTCTCGCCCATCTCGACTCAC
CCACCCGCCCATCTCGGAACCCACTGCCGACCGCAAATACTCACACACGACCCCTTACCCCTTCCCGTCCGACAC
GCCAATCTATCACCGTCTCTCGAATGACTTATCGCGTGGCCTGCTTGCCATAGCACCTGTTCCCGACGACTCGTT
AATCATGGCTGAAACAGCATCCGACCACAGGCCACCCGACCAAACTTCTCACCACAAACATGGCCGCTCCAGGCC
TTCTGCCCAGTCGCTCGACGCCGCGCCGTCCATCTGTCGAATATGCCGCGGTGAAGGCACAGCTGCCGAGCCGCT
CTTTTACCCTTGCAAATGCAGCGGCAGCATCAAGTACGTCCATCAGGACTGTCTGATGGAGTGGCTGTCACACTC
CCAGAAGAAGTACTGCGAGCTCTGCAAGACGTCGTTCCGCTTCACCAAGCTCTATGCGCCCGACATGCCAAAGTC
TCTGCCCTTGCACGTCTTTGTCGAGCACATGGGCAGGTACTTGTTGCGGAACCTGCTGACATGGTTGCGGGCCGC
CGTCACCATCAGCGTCTGGGCATGCTGGCTGCCCTACTTCATGCGCTCCGTCTGGTCCTTCATGTTCTGGGTCAG
TGACGAGGGCCTCGGCGGTGGCTCCTTTCTCTCTCGAGCCAACGACACCGACGCGACTACGCTGTGGCTTTCCGC
CTCTGTTGGTACATGTCCAGCCAGTCCATTGCTGGCCACAACCACCACTTCTGCAACCGAGGCGGCTGCCGTGCT
CGAGAGCCTCGACGGTGAAGACCTCTCCGAATATCTCTTGCGCATTCTATTCGGCTCGCTCGGCATGCCCATGAA
GCTTGGCCGTCCCGATCTACGACCACATTACGACATTGCCAACGCTTCTTTGGCAAATGGCGTCAGCATGCCACC
TGCGTCCCTTCTGGGCAACATGAACTTTCTCCATAACCTCACTCGAAGCCCGACGCTGAACCGGACCGTCGTTAC
GGTTCTTGAGGGACAAATCATCACTGTTTTGGTCATCATCTGCTTCATACTCGTCATCTTGGTGCGAGACTATGT
GGTCCAGCAGCAGCCTGAAATCAACATGCGAGCCGCCTTTGAGGAGCCAGGAAATGACCTTGCTCCCGAAGATCA
TGACATGGCCCAGGCCGCCGTCGCCGAGCCAGCCCAACAAGCTCAAAGGCCAGACTCCGACGACGAAGCATCGGA
TAACGTTGATAGGCCGGCGGTTGCACCGGCATCCGAAGCCGTCCCCGGAAACAACGATGCAGCCGGCGCCGCTCT
TGTCGCGCACGCCGAGCTAGCCGGTTCGCAACGAGACTCTTCCGGCCATCTCGGCACGGATCAATTCCACAATAC
CCCAACTCCGGCTGTGGCAGTCAACACTAATGGCCAGGGTAACAGCAGCGTCACGGATGCTGCGCGAGCACATCT
GCAAGACAGCGACGAATCTGATATCCAAAAAAGGATAGATTCTGTGTACGAGAAGGCTGTAGAAGAAGACTTCAA
AAAATGGGACGACACGGGGAGGCCGTCTTCGAACAACGTGGAGGAACCCGGCCGACAATCTGACTTGGCCAGACT
TGGGGATCCTGCGAATCCTTCGACGGAAGCTGGACCTAGCGAAGAGACCGACCCGGCGCAGTCATCCAGTATCAC
AGCGGCGAACAAGTCATCCAAGAACAAGGGGAAAGAGCGGGAGCTGACTTCGCCGGGGCCCGGTTTCGATCTGCA
AGGTGGCCCCTCGAGAAAGCGTGCTGCCTCGGAGGGGCCGGCGAGGAGACGTGCTGCTTCGGACGGGCCTTTCCA
TCAACCTGGGATGAACCCTTTGGGAAGCAACAATTGGTCCTTTTCCCGCCTACCGGCTGACGACCCTGTCGACGG
CGATTCGGTTCGAACGCCTGCATCTGCCTCAGCAGCCGACGTAGAAGCATCGTCGCTACCAAAGGACGACGACCT
GCCGGTCACCTCTACGTCGATGGACGAGGGGTCGCACCTCAACGGCACAGCCCAGGCTCAACCCTACGACGATGA
TGTCAGAGAGCCGTCGCGTCATCGCGGTGCCGCGCTGGAGGAGCAAAACCCAGTCGACGAAGCTGCCGCTGATGG
GCAAGAGGCGGCAGGTTTGGTCGGCCGCGTCGCTCATTTCATGTGGGGGGATCTCGAAGAACCCCAAGACGGAAT
CGTCGAAAACGTCGCCGGCGAAGACGCCGATGCCGATGACGAGGACCCCTGGATCGACGTTCCGATGGCCGAGGG
CGCCGACGAGAATGGCGATGTCGACTTAGGGGACGTTGACGGCGTCGTCGCTGGGGCGGGCTTGGACGCCGAAGC
ACTTGATGACCTCGAGGACTTTGAGGGTGTCATGGAGCTCATCGGCATGCGCGGGCCCATCGCTGGCCTGTTCCA
GAACGCCATCTTCTGCGCCGTCCTCGTGTCCGTCACGATCTTTGCCTGCATCTTTATTCCTTACAACATGGGCCG
CATCGCTTTCTGGGTTGTGGCAAACCCGATGCAGCTCGTCCGCATACTCTTCGAGTTTTCCAAGGTAGTACAGGA
CGCCGTGATTATGCTGGGCGGCCTTAGCTCGTGGTTCGTCCTCAATCTGCTGGACATGTTCACTGGTCTGCTCGG
TGGGCCGCTGGCCGCCCAGATCGTGACGGTGAGAAAGGCATCGTGGGGGCTTTGGACCGGGGCCGGGACGAGGGT
CATGGATTACGCCCTACTGGAATTCCCCATGTCTGCCTCGGAGATGCACAACTTCTCGGCCATCAGCCACGAGGC
CCTCAACACTGTCAAAGGCTCCGTCGCGTCGGCCCTTGGGGCCCTTGGGGTTTGCCTCGCGTCCATACTGACACC
GAGCTTCTATGCGGTCGACAGGGGGTCCTTGGTTGCAGCGGCCTCGGCTATCATCACGACCCTCATCAACCTCAA
GGCCGCTCTGTCGCTCGTCCTCGATCCAGGCTCCTGGGTCATCGACCTCAGCAGAACAGAGGCACGTGCGGCCAT
CGACCCGGGCCTGGCCTACTGGTCCAGCCTCGACCGCTTCTGGGCCATCCTCGCCGGCTACCTGACCATCTTCGC
AATGGGCGCCATGTATTTGCGGAGAGGTACGCCCTTCTCGAGGAACAACATGGTGCAGGCGTGGGAGGCCGGCAT
CATCGACACGCTGCACCAGGCTAGCGGCATCATGAAAGTCATCGTCATCATTAGCATCGAGATGCTGGTCTTCCC
GCTCTACTGCGGGCTTCTGCTCGACGCCGCCCTCCTGCCACTCTTTGAGAACACGACGATCAAATCACGAATCCT
CTTCACGTACAATTTTCCCCTTACGTCAATCTTCGTCCACTGGTTTGTGGGAACTGGATACATGTTTCACTTTGC
TCTGTTTGTGTCCATGTGCCGCAAGATTATGCGACCTGGCGTGCTATGTGAGGGCCAGGCCTCCGTGACTATGGA
TATAGCCATTGGCTGACGTTATCGCAGATTTCATTAGAGATCCAGATGACCCCGAGTTCCACCCCATTCGCGATG
TGTTGGAGAGGAGTCTGACGACGCAGCTGCGAAAGATTCTCTTCTCCGCCTTTGTATACGGCGCACTCGTCATCG
TCTGCCTCGGGGGTGTCGTCTGGAGTCTTTCGTACACGTTACCCGGAGTGCTACCTATCCACTATTCGTCCAACG
AGCCGGTCCTCGAATTCCCCGTCGATCTCCTCTTCTACAACTTTCTCATGCCCCAGGCGGTCAAAGTTCTCAAAC
CAGGCGACGGGCTGCATGCCATGTACACGTGGTGGTTTCGCAAGTGCGCTCGCGGCCTGCGACTTACCTTTTTCC
TCTTTGGAGAACGGCGCATTGACGAGGAGGGAACCCTTCAACTTGGCGTCGACACGGCGGGCAGCTTTCCCCGCC
ACAAGAGGCTATTCCTCGAGCTCAACGAGCATAACAAGGTCGTTCCCAAGTCCTGGCGCGACACGTTCGAGGTCG
GTGATGCCAAGCCGAACCCGTCGCTGTCCAGCCGCGAGGAGAGGCTATTGCGCCGCAAGAAGCAGCACCTAGTAG
CCTCGGGCCAGCTCACGCGAAGCGGGCGATTCGTGCGAGCCCCGGCGTCAGACCGCGTCAATATTCCCAAGGGTA
AGCCGGTCTTGCTCCACGTGACGGAGCTGGGCCGGCGCAAGGACGGCAAGCCAGACAATGACATTTACGCGTCCG
GCCAGTACCAGATGGTCTACATCCCGCCAAACTTTCGCGTCAGGATCTTCCTGTTCATCCTCTTCATCTGGCTGT
TCGCGGCGGTGACAGGGGTTGGCATCACCATGGCCCCGCTGGCGCTGGGCCGGAAGATGTTCAAGCTGCTGATTC
CCGAGCACATTCGGACCAACGACATTTACGCCTTTAGCATCGGAATATACCTCCTGGGCACTGCAAGCTACTCTG
TCCTCTGCGTCCAGAAGATCATGGCCGAGGTCCAGGCATGGGTTCGAAAGGCATGGATCGAGGCGACGAGAGGGC
ACGCTCTCAGACATGCATGGACCGGTCTCTTACGCGGCGCCAAGTTGGTGTACGCCTACACGTTCATCCTGATCG
TGTTTCCGCTCCTGTCGTCTACTCTGATGGAGCTGTACATTACGATTCCGCTGCACACATACATGGATCCCCCGA
CGGCGGAACCGGCGCCGAAGCAGGCCGGCGAGGGAGGCCGGCATACGATCCGCGTCATCCAGGCGTGGACCCTGG
GGCTTCTGTATCTCAATCTTGGGACGAGGATGGTCAAGTCCCTGTTCCCCGAGAGTCGAGCGGCGTTGGCGGTGC
GCATCATGATGCGGAGGGGATGGTTGCGACCCGACATTGGCATCCTGACAAGGGCGTTTGTGATGCCCGGACTGG
CCTTGGCGGCAGTAGCAATGTTCGGGCCACCGCTGATGGCGAGTTTCCTGATCGATGCGGAGGTCTTAGGCAACG
AAGTCCACGGGGCGGGCGAGCTGGCGGCCATCTACCGACACTCGTATCCGGCGGCGGCGCTGGTGGTCGTGGTGG
TCAAGCAAGCAGCCGGCATGGCCAGGGTCTTCAGGGGCTGGAGGGCCGGAATACGCGACGAGGCCTATCTTATCG
GGGAGCGGCTACACAATTTTGGCATAACGGCGGCGGGAGGCGGTAGGGCCAAGCGGGCTTGGGGGGCGGGGAGGT
CGAGGCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail