Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7965
Gene name
Locationscaffold_83:5248..10734
Strand+
Gene length (bp)5486
Transcript length (bp)5298
Coding sequence length (bp)5295
Protein length (aa) 1765

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12906 RINGv RING-variant domain 1.0E-16 143 189

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O60103|DOA10_SCHPO ERAD-associated E3 ubiquitin-protein ligase doa10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=doa10 PE=1 SV=1 840 1748 6.0E-82
sp|O60103|DOA10_SCHPO ERAD-associated E3 ubiquitin-protein ligase doa10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=doa10 PE=1 SV=1 136 257 7.0E-31
sp|F4JKK0|SUD1_ARATH Probable E3 ubiquitin ligase SUD1 OS=Arabidopsis thaliana GN=SUD1 PE=1 SV=1 1116 1314 3.0E-30
sp|F4JKK0|SUD1_ARATH Probable E3 ubiquitin ligase SUD1 OS=Arabidopsis thaliana GN=SUD1 PE=1 SV=1 142 283 2.0E-25
sp|P40318|DOA10_YEAST ERAD-associated E3 ubiquitin-protein ligase DOA10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSM4 PE=1 SV=1 1095 1523 3.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O60103|DOA10_SCHPO ERAD-associated E3 ubiquitin-protein ligase doa10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=doa10 PE=1 SV=1 840 1748 6.0E-82
sp|O60103|DOA10_SCHPO ERAD-associated E3 ubiquitin-protein ligase doa10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=doa10 PE=1 SV=1 136 257 7.0E-31
sp|F4JKK0|SUD1_ARATH Probable E3 ubiquitin ligase SUD1 OS=Arabidopsis thaliana GN=SUD1 PE=1 SV=1 1116 1314 3.0E-30
sp|F4JKK0|SUD1_ARATH Probable E3 ubiquitin ligase SUD1 OS=Arabidopsis thaliana GN=SUD1 PE=1 SV=1 142 283 2.0E-25
sp|P40318|DOA10_YEAST ERAD-associated E3 ubiquitin-protein ligase DOA10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSM4 PE=1 SV=1 1095 1523 3.0E-25
sp|Q5R9W1|MARH6_PONAB E3 ubiquitin-protein ligase MARCH6 OS=Pongo abelii GN=MARCH6 PE=2 SV=1 138 210 2.0E-24
sp|O60337|MARH6_HUMAN E3 ubiquitin-protein ligase MARCH6 OS=Homo sapiens GN=MARCH6 PE=1 SV=2 138 210 2.0E-24
sp|Q6ZQ89|MARH6_MOUSE E3 ubiquitin-protein ligase MARCH6 OS=Mus musculus GN=March6 PE=2 SV=2 138 210 3.0E-24
sp|Q5R9W1|MARH6_PONAB E3 ubiquitin-protein ligase MARCH6 OS=Pongo abelii GN=MARCH6 PE=2 SV=1 1126 1256 4.0E-21
sp|O60337|MARH6_HUMAN E3 ubiquitin-protein ligase MARCH6 OS=Homo sapiens GN=MARCH6 PE=1 SV=2 1126 1256 4.0E-21
sp|Q6ZQ89|MARH6_MOUSE E3 ubiquitin-protein ligase MARCH6 OS=Mus musculus GN=March6 PE=2 SV=2 1126 1256 4.0E-21
sp|P40318|DOA10_YEAST ERAD-associated E3 ubiquitin-protein ligase DOA10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSM4 PE=1 SV=1 123 238 2.0E-16
sp|F4JKK0|SUD1_ARATH Probable E3 ubiquitin ligase SUD1 OS=Arabidopsis thaliana GN=SUD1 PE=1 SV=1 1448 1745 8.0E-14
sp|Q8TCQ1|MARH1_HUMAN E3 ubiquitin-protein ligase MARCH1 OS=Homo sapiens GN=MARCH1 PE=1 SV=1 131 193 3.0E-13
sp|Q6NZQ8|MARH1_MOUSE E3 ubiquitin-protein ligase MARCH1 OS=Mus musculus GN=March1 PE=1 SV=2 131 193 3.0E-13
sp|Q28IK8|MARH8_XENTR E3 ubiquitin-protein ligase MARCH8 OS=Xenopus tropicalis GN=march8 PE=2 SV=1 129 193 2.0E-12
sp|Q0VD59|MARH8_BOVIN E3 ubiquitin-protein ligase MARCH8 OS=Bos taurus GN=MARCH8 PE=2 SV=1 131 193 2.0E-12
sp|Q9DBD2|MARH8_MOUSE E3 ubiquitin-protein ligase MARCH8 OS=Mus musculus GN=March8 PE=2 SV=1 91 193 3.0E-12
sp|Q5XH39|MARH8_XENLA E3 ubiquitin-protein ligase MARCH8 OS=Xenopus laevis GN=march8 PE=2 SV=2 131 193 3.0E-12
sp|Q5T0T0|MARH8_HUMAN E3 ubiquitin-protein ligase MARCH8 OS=Homo sapiens GN=MARCH8 PE=1 SV=1 131 193 4.0E-12
sp|Q68FA7|MARH3_XENTR E3 ubiquitin-protein ligase MARCH3 OS=Xenopus tropicalis GN=march3 PE=2 SV=1 132 239 1.0E-11
sp|Q0IH10|MARH3_XENLA E3 ubiquitin-protein ligase MARCH3 OS=Xenopus laevis GN=march3 PE=2 SV=1 128 239 3.0E-11
sp|Q86UD3|MARH3_HUMAN E3 ubiquitin-protein ligase MARCH3 OS=Homo sapiens GN=MARCH3 PE=2 SV=1 142 239 8.0E-11
sp|Q5PQ35|MARH2_XENLA E3 ubiquitin-protein ligase MARCH2 OS=Xenopus laevis GN=march2 PE=2 SV=1 142 193 2.0E-10
sp|Q28EX7|MARH2_XENTR E3 ubiquitin-protein ligase MARCH2 OS=Xenopus tropicalis GN=march2 PE=2 SV=1 142 193 2.0E-10
sp|Q5I0I2|MARH2_RAT E3 ubiquitin-protein ligase MARCH2 OS=Rattus norvegicus GN=March2 PE=1 SV=1 143 201 3.0E-10
sp|A0JN69|MARH3_BOVIN E3 ubiquitin-protein ligase MARCH3 OS=Bos taurus GN=MARCH3 PE=2 SV=1 142 239 2.0E-09
sp|Q5XIE5|MARH3_RAT E3 ubiquitin-protein ligase MARCH3 OS=Rattus norvegicus GN=March3 PE=1 SV=1 142 239 2.0E-09
sp|Q8BRX9|MARH3_MOUSE E3 ubiquitin-protein ligase MARCH3 OS=Mus musculus GN=March3 PE=2 SV=1 142 239 2.0E-09
sp|Q32L65|MARH2_BOVIN E3 ubiquitin-protein ligase MARCH2 OS=Bos taurus GN=MARCH2 PE=2 SV=1 142 197 3.0E-09
sp|Q1LVZ2|MARH2_DANRE E3 ubiquitin-protein ligase MARCH2 OS=Danio rerio GN=march2 PE=2 SV=1 142 201 4.0E-09
sp|Q9P0N8|MARH2_HUMAN E3 ubiquitin-protein ligase MARCH2 OS=Homo sapiens GN=MARCH2 PE=1 SV=1 142 197 9.0E-09
sp|A6NNE9|MARHB_HUMAN E3 ubiquitin-protein ligase MARCH11 OS=Homo sapiens GN=MARCH11 PE=2 SV=3 119 249 9.0E-09
sp|Q99M02|MARH2_MOUSE E3 ubiquitin-protein ligase MARCH2 OS=Mus musculus GN=March2 PE=2 SV=1 142 197 1.0E-08
sp|Q8CBH7|MARHB_MOUSE E3 ubiquitin-protein ligase MARCH11 OS=Mus musculus GN=March11 PE=2 SV=2 124 250 3.0E-08
sp|A6P320|MARHB_RAT E3 ubiquitin-protein ligase MARCH11 OS=Rattus norvegicus GN=March11 PE=1 SV=1 124 249 3.0E-08
sp|Q5XIV2|MARHA_RAT Probable E3 ubiquitin-protein ligase MARCH10 OS=Rattus norvegicus GN=March10 PE=1 SV=1 143 199 3.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0046914 transition metal ion binding No
GO:0046872 metal ion binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0043167 ion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 225 244 19
2 380 402 22
3 852 874 22
4 917 939 22
5 989 1011 22
6 1016 1038 22
7 1069 1088 19
8 1119 1141 22
9 1161 1183 22
10 1225 1247 22
11 1457 1479 22
12 1499 1521 22
13 1553 1575 22
14 1650 1672 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7965
MFLSSQYIFHVLTEPGGFAPPRQRASRCQRQYLPRRPHTKTLLPTVCRFSRPSRLTHPPISEPTADRKYSHTTPY
PFPSDTPIYHRLSNDLSRGLLAIAPVPDDSLIMAETASDHRPPDQTSHHKHGRSRPSAQSLDAAPSICRICRGEG
TAAEPLFYPCKCSGSIKYVHQDCLMEWLSHSQKKYCELCKTSFRFTKLYAPDMPKSLPLHVFVEHMGRYLLRNLL
TWLRAAVTISVWACWLPYFMRSVWSFMFWVSDEGLGGGSFLSRANDTDATTLWLSASVGTCPASPLLATTTTSAT
EAAAVLESLDGEDLSEYLLRILFGSLGMPMKLGRPDLRPHYDIANASLANGVSMPPASLLGNMNFLHNLTRSPTL
NRTVVTVLEGQIITVLVIICFILVILVRDYVVQQQPEINMRAAFEEPGNDLAPEDHDMAQAAVAEPAQQAQRPDS
DDEASDNVDRPAVAPASEAVPGNNDAAGAALVAHAELAGSQRDSSGHLGTDQFHNTPTPAVAVNTNGQGNSSVTD
AARAHLQDSDESDIQKRIDSVYEKAVEEDFKKWDDTGRPSSNNVEEPGRQSDLARLGDPANPSTEAGPSEETDPA
QSSSITAANKSSKNKGKERELTSPGPGFDLQGGPSRKRAASEGPARRRAASDGPFHQPGMNPLGSNNWSFSRLPA
DDPVDGDSVRTPASASAADVEASSLPKDDDLPVTSTSMDEGSHLNGTAQAQPYDDDVREPSRHRGAALEEQNPVD
EAAADGQEAAGLVGRVAHFMWGDLEEPQDGIVENVAGEDADADDEDPWIDVPMAEGADENGDVDLGDVDGVVAGA
GLDAEALDDLEDFEGVMELIGMRGPIAGLFQNAIFCAVLVSVTIFACIFIPYNMGRIAFWVVANPMQLVRILFEF
SKVVQDAVIMLGGLSSWFVLNLLDMFTGLLGGPLAAQIVTVRKASWGLWTGAGTRVMDYALLEFPMSASEMHNFS
AISHEALNTVKGSVASALGALGVCLASILTPSFYAVDRGSLVAAASAIITTLINLKAALSLVLDPGSWVIDLSRT
EARAAIDPGLAYWSSLDRFWAILAGYLTIFAMGAMYLRRGTPFSRNNMVQAWEAGIIDTLHQASGIMKVIVIISI
EMLVFPLYCGLLLDAALLPLFENTTIKSRILFTYNFPLTSIFVHWFVGTGYMFHFALFVSMCRKIMRPGVLYFIR
DPDDPEFHPIRDVLERSLTTQLRKILFSAFVYGALVIVCLGGVVWSLSYTLPGVLPIHYSSNEPVLEFPVDLLFY
NFLMPQAVKVLKPGDGLHAMYTWWFRKCARGLRLTFFLFGERRIDEEGTLQLGVDTAGSFPRHKRLFLELNEHNK
VVPKSWRDTFEVGDAKPNPSLSSREERLLRRKKQHLVASGQLTRSGRFVRAPASDRVNIPKGKPVLLHVTELGRR
KDGKPDNDIYASGQYQMVYIPPNFRVRIFLFILFIWLFAAVTGVGITMAPLALGRKMFKLLIPEHIRTNDIYAFS
IGIYLLGTASYSVLCVQKIMAEVQAWVRKAWIEATRGHALRHAWTGLLRGAKLVYAYTFILIVFPLLSSTLMELY
ITIPLHTYMDPPTAEPAPKQAGEGGRHTIRVIQAWTLGLLYLNLGTRMVKSLFPESRAALAVRIMMRRGWLRPDI
GILTRAFVMPGLALAAVAMFGPPLMASFLIDAEVLGNEVHGAGELAAIYRHSYPAAALVVVVVKQAAGMARVFRG
WRAGIRDEAYLIGERLHNFGITAAGGGRAKRAWGAGRSRL
Coding >Ophio5|7965
ATGTTTCTTTCAAGTCAATACATCTTTCACGTCCTCACGGAGCCGGGTGGCTTCGCACCTCCCCGTCAAAGGGCC
TCACGCTGCCAGCGTCAATATCTGCCTCGACGGCCGCACACAAAAACACTTCTCCCGACAGTCTGCCGCTTCTCT
CGCCCATCTCGACTCACCCACCCGCCCATCTCGGAACCCACTGCCGACCGCAAATACTCACACACGACCCCTTAC
CCCTTCCCGTCCGACACGCCAATCTATCACCGTCTCTCGAATGACTTATCGCGTGGCCTGCTTGCCATAGCACCT
GTTCCCGACGACTCGTTAATCATGGCTGAAACAGCATCCGACCACAGGCCACCCGACCAAACTTCTCACCACAAA
CATGGCCGCTCCAGGCCTTCTGCCCAGTCGCTCGACGCCGCGCCGTCCATCTGTCGAATATGCCGCGGTGAAGGC
ACAGCTGCCGAGCCGCTCTTTTACCCTTGCAAATGCAGCGGCAGCATCAAGTACGTCCATCAGGACTGTCTGATG
GAGTGGCTGTCACACTCCCAGAAGAAGTACTGCGAGCTCTGCAAGACGTCGTTCCGCTTCACCAAGCTCTATGCG
CCCGACATGCCAAAGTCTCTGCCCTTGCACGTCTTTGTCGAGCACATGGGCAGGTACTTGTTGCGGAACCTGCTG
ACATGGTTGCGGGCCGCCGTCACCATCAGCGTCTGGGCATGCTGGCTGCCCTACTTCATGCGCTCCGTCTGGTCC
TTCATGTTCTGGGTCAGTGACGAGGGCCTCGGCGGTGGCTCCTTTCTCTCTCGAGCCAACGACACCGACGCGACT
ACGCTGTGGCTTTCCGCCTCTGTTGGTACATGTCCAGCCAGTCCATTGCTGGCCACAACCACCACTTCTGCAACC
GAGGCGGCTGCCGTGCTCGAGAGCCTCGACGGTGAAGACCTCTCCGAATATCTCTTGCGCATTCTATTCGGCTCG
CTCGGCATGCCCATGAAGCTTGGCCGTCCCGATCTACGACCACATTACGACATTGCCAACGCTTCTTTGGCAAAT
GGCGTCAGCATGCCACCTGCGTCCCTTCTGGGCAACATGAACTTTCTCCATAACCTCACTCGAAGCCCGACGCTG
AACCGGACCGTCGTTACGGTTCTTGAGGGACAAATCATCACTGTTTTGGTCATCATCTGCTTCATACTCGTCATC
TTGGTGCGAGACTATGTGGTCCAGCAGCAGCCTGAAATCAACATGCGAGCCGCCTTTGAGGAGCCAGGAAATGAC
CTTGCTCCCGAAGATCATGACATGGCCCAGGCCGCCGTCGCCGAGCCAGCCCAACAAGCTCAAAGGCCAGACTCC
GACGACGAAGCATCGGATAACGTTGATAGGCCGGCGGTTGCACCGGCATCCGAAGCCGTCCCCGGAAACAACGAT
GCAGCCGGCGCCGCTCTTGTCGCGCACGCCGAGCTAGCCGGTTCGCAACGAGACTCTTCCGGCCATCTCGGCACG
GATCAATTCCACAATACCCCAACTCCGGCTGTGGCAGTCAACACTAATGGCCAGGGTAACAGCAGCGTCACGGAT
GCTGCGCGAGCACATCTGCAAGACAGCGACGAATCTGATATCCAAAAAAGGATAGATTCTGTGTACGAGAAGGCT
GTAGAAGAAGACTTCAAAAAATGGGACGACACGGGGAGGCCGTCTTCGAACAACGTGGAGGAACCCGGCCGACAA
TCTGACTTGGCCAGACTTGGGGATCCTGCGAATCCTTCGACGGAAGCTGGACCTAGCGAAGAGACCGACCCGGCG
CAGTCATCCAGTATCACAGCGGCGAACAAGTCATCCAAGAACAAGGGGAAAGAGCGGGAGCTGACTTCGCCGGGG
CCCGGTTTCGATCTGCAAGGTGGCCCCTCGAGAAAGCGTGCTGCCTCGGAGGGGCCGGCGAGGAGACGTGCTGCT
TCGGACGGGCCTTTCCATCAACCTGGGATGAACCCTTTGGGAAGCAACAATTGGTCCTTTTCCCGCCTACCGGCT
GACGACCCTGTCGACGGCGATTCGGTTCGAACGCCTGCATCTGCCTCAGCAGCCGACGTAGAAGCATCGTCGCTA
CCAAAGGACGACGACCTGCCGGTCACCTCTACGTCGATGGACGAGGGGTCGCACCTCAACGGCACAGCCCAGGCT
CAACCCTACGACGATGATGTCAGAGAGCCGTCGCGTCATCGCGGTGCCGCGCTGGAGGAGCAAAACCCAGTCGAC
GAAGCTGCCGCTGATGGGCAAGAGGCGGCAGGTTTGGTCGGCCGCGTCGCTCATTTCATGTGGGGGGATCTCGAA
GAACCCCAAGACGGAATCGTCGAAAACGTCGCCGGCGAAGACGCCGATGCCGATGACGAGGACCCCTGGATCGAC
GTTCCGATGGCCGAGGGCGCCGACGAGAATGGCGATGTCGACTTAGGGGACGTTGACGGCGTCGTCGCTGGGGCG
GGCTTGGACGCCGAAGCACTTGATGACCTCGAGGACTTTGAGGGTGTCATGGAGCTCATCGGCATGCGCGGGCCC
ATCGCTGGCCTGTTCCAGAACGCCATCTTCTGCGCCGTCCTCGTGTCCGTCACGATCTTTGCCTGCATCTTTATT
CCTTACAACATGGGCCGCATCGCTTTCTGGGTTGTGGCAAACCCGATGCAGCTCGTCCGCATACTCTTCGAGTTT
TCCAAGGTAGTACAGGACGCCGTGATTATGCTGGGCGGCCTTAGCTCGTGGTTCGTCCTCAATCTGCTGGACATG
TTCACTGGTCTGCTCGGTGGGCCGCTGGCCGCCCAGATCGTGACGGTGAGAAAGGCATCGTGGGGGCTTTGGACC
GGGGCCGGGACGAGGGTCATGGATTACGCCCTACTGGAATTCCCCATGTCTGCCTCGGAGATGCACAACTTCTCG
GCCATCAGCCACGAGGCCCTCAACACTGTCAAAGGCTCCGTCGCGTCGGCCCTTGGGGCCCTTGGGGTTTGCCTC
GCGTCCATACTGACACCGAGCTTCTATGCGGTCGACAGGGGGTCCTTGGTTGCAGCGGCCTCGGCTATCATCACG
ACCCTCATCAACCTCAAGGCCGCTCTGTCGCTCGTCCTCGATCCAGGCTCCTGGGTCATCGACCTCAGCAGAACA
GAGGCACGTGCGGCCATCGACCCGGGCCTGGCCTACTGGTCCAGCCTCGACCGCTTCTGGGCCATCCTCGCCGGC
TACCTGACCATCTTCGCAATGGGCGCCATGTATTTGCGGAGAGGTACGCCCTTCTCGAGGAACAACATGGTGCAG
GCGTGGGAGGCCGGCATCATCGACACGCTGCACCAGGCTAGCGGCATCATGAAAGTCATCGTCATCATTAGCATC
GAGATGCTGGTCTTCCCGCTCTACTGCGGGCTTCTGCTCGACGCCGCCCTCCTGCCACTCTTTGAGAACACGACG
ATCAAATCACGAATCCTCTTCACGTACAATTTTCCCCTTACGTCAATCTTCGTCCACTGGTTTGTGGGAACTGGA
TACATGTTTCACTTTGCTCTGTTTGTGTCCATGTGCCGCAAGATTATGCGACCTGGCGTGCTATATTTCATTAGA
GATCCAGATGACCCCGAGTTCCACCCCATTCGCGATGTGTTGGAGAGGAGTCTGACGACGCAGCTGCGAAAGATT
CTCTTCTCCGCCTTTGTATACGGCGCACTCGTCATCGTCTGCCTCGGGGGTGTCGTCTGGAGTCTTTCGTACACG
TTACCCGGAGTGCTACCTATCCACTATTCGTCCAACGAGCCGGTCCTCGAATTCCCCGTCGATCTCCTCTTCTAC
AACTTTCTCATGCCCCAGGCGGTCAAAGTTCTCAAACCAGGCGACGGGCTGCATGCCATGTACACGTGGTGGTTT
CGCAAGTGCGCTCGCGGCCTGCGACTTACCTTTTTCCTCTTTGGAGAACGGCGCATTGACGAGGAGGGAACCCTT
CAACTTGGCGTCGACACGGCGGGCAGCTTTCCCCGCCACAAGAGGCTATTCCTCGAGCTCAACGAGCATAACAAG
GTCGTTCCCAAGTCCTGGCGCGACACGTTCGAGGTCGGTGATGCCAAGCCGAACCCGTCGCTGTCCAGCCGCGAG
GAGAGGCTATTGCGCCGCAAGAAGCAGCACCTAGTAGCCTCGGGCCAGCTCACGCGAAGCGGGCGATTCGTGCGA
GCCCCGGCGTCAGACCGCGTCAATATTCCCAAGGGTAAGCCGGTCTTGCTCCACGTGACGGAGCTGGGCCGGCGC
AAGGACGGCAAGCCAGACAATGACATTTACGCGTCCGGCCAGTACCAGATGGTCTACATCCCGCCAAACTTTCGC
GTCAGGATCTTCCTGTTCATCCTCTTCATCTGGCTGTTCGCGGCGGTGACAGGGGTTGGCATCACCATGGCCCCG
CTGGCGCTGGGCCGGAAGATGTTCAAGCTGCTGATTCCCGAGCACATTCGGACCAACGACATTTACGCCTTTAGC
ATCGGAATATACCTCCTGGGCACTGCAAGCTACTCTGTCCTCTGCGTCCAGAAGATCATGGCCGAGGTCCAGGCA
TGGGTTCGAAAGGCATGGATCGAGGCGACGAGAGGGCACGCTCTCAGACATGCATGGACCGGTCTCTTACGCGGC
GCCAAGTTGGTGTACGCCTACACGTTCATCCTGATCGTGTTTCCGCTCCTGTCGTCTACTCTGATGGAGCTGTAC
ATTACGATTCCGCTGCACACATACATGGATCCCCCGACGGCGGAACCGGCGCCGAAGCAGGCCGGCGAGGGAGGC
CGGCATACGATCCGCGTCATCCAGGCGTGGACCCTGGGGCTTCTGTATCTCAATCTTGGGACGAGGATGGTCAAG
TCCCTGTTCCCCGAGAGTCGAGCGGCGTTGGCGGTGCGCATCATGATGCGGAGGGGATGGTTGCGACCCGACATT
GGCATCCTGACAAGGGCGTTTGTGATGCCCGGACTGGCCTTGGCGGCAGTAGCAATGTTCGGGCCACCGCTGATG
GCGAGTTTCCTGATCGATGCGGAGGTCTTAGGCAACGAAGTCCACGGGGCGGGCGAGCTGGCGGCCATCTACCGA
CACTCGTATCCGGCGGCGGCGCTGGTGGTCGTGGTGGTCAAGCAAGCAGCCGGCATGGCCAGGGTCTTCAGGGGC
TGGAGGGCCGGAATACGCGACGAGGCCTATCTTATCGGGGAGCGGCTACACAATTTTGGCATAACGGCGGCGGGA
GGCGGTAGGGCCAAGCGGGCTTGGGGGGCGGGGAGGTCGAGGCTG
Transcript >Ophio5|7965
ATGTTTCTTTCAAGTCAATACATCTTTCACGTCCTCACGGAGCCGGGTGGCTTCGCACCTCCCCGTCAAAGGGCC
TCACGCTGCCAGCGTCAATATCTGCCTCGACGGCCGCACACAAAAACACTTCTCCCGACAGTCTGCCGCTTCTCT
CGCCCATCTCGACTCACCCACCCGCCCATCTCGGAACCCACTGCCGACCGCAAATACTCACACACGACCCCTTAC
CCCTTCCCGTCCGACACGCCAATCTATCACCGTCTCTCGAATGACTTATCGCGTGGCCTGCTTGCCATAGCACCT
GTTCCCGACGACTCGTTAATCATGGCTGAAACAGCATCCGACCACAGGCCACCCGACCAAACTTCTCACCACAAA
CATGGCCGCTCCAGGCCTTCTGCCCAGTCGCTCGACGCCGCGCCGTCCATCTGTCGAATATGCCGCGGTGAAGGC
ACAGCTGCCGAGCCGCTCTTTTACCCTTGCAAATGCAGCGGCAGCATCAAGTACGTCCATCAGGACTGTCTGATG
GAGTGGCTGTCACACTCCCAGAAGAAGTACTGCGAGCTCTGCAAGACGTCGTTCCGCTTCACCAAGCTCTATGCG
CCCGACATGCCAAAGTCTCTGCCCTTGCACGTCTTTGTCGAGCACATGGGCAGGTACTTGTTGCGGAACCTGCTG
ACATGGTTGCGGGCCGCCGTCACCATCAGCGTCTGGGCATGCTGGCTGCCCTACTTCATGCGCTCCGTCTGGTCC
TTCATGTTCTGGGTCAGTGACGAGGGCCTCGGCGGTGGCTCCTTTCTCTCTCGAGCCAACGACACCGACGCGACT
ACGCTGTGGCTTTCCGCCTCTGTTGGTACATGTCCAGCCAGTCCATTGCTGGCCACAACCACCACTTCTGCAACC
GAGGCGGCTGCCGTGCTCGAGAGCCTCGACGGTGAAGACCTCTCCGAATATCTCTTGCGCATTCTATTCGGCTCG
CTCGGCATGCCCATGAAGCTTGGCCGTCCCGATCTACGACCACATTACGACATTGCCAACGCTTCTTTGGCAAAT
GGCGTCAGCATGCCACCTGCGTCCCTTCTGGGCAACATGAACTTTCTCCATAACCTCACTCGAAGCCCGACGCTG
AACCGGACCGTCGTTACGGTTCTTGAGGGACAAATCATCACTGTTTTGGTCATCATCTGCTTCATACTCGTCATC
TTGGTGCGAGACTATGTGGTCCAGCAGCAGCCTGAAATCAACATGCGAGCCGCCTTTGAGGAGCCAGGAAATGAC
CTTGCTCCCGAAGATCATGACATGGCCCAGGCCGCCGTCGCCGAGCCAGCCCAACAAGCTCAAAGGCCAGACTCC
GACGACGAAGCATCGGATAACGTTGATAGGCCGGCGGTTGCACCGGCATCCGAAGCCGTCCCCGGAAACAACGAT
GCAGCCGGCGCCGCTCTTGTCGCGCACGCCGAGCTAGCCGGTTCGCAACGAGACTCTTCCGGCCATCTCGGCACG
GATCAATTCCACAATACCCCAACTCCGGCTGTGGCAGTCAACACTAATGGCCAGGGTAACAGCAGCGTCACGGAT
GCTGCGCGAGCACATCTGCAAGACAGCGACGAATCTGATATCCAAAAAAGGATAGATTCTGTGTACGAGAAGGCT
GTAGAAGAAGACTTCAAAAAATGGGACGACACGGGGAGGCCGTCTTCGAACAACGTGGAGGAACCCGGCCGACAA
TCTGACTTGGCCAGACTTGGGGATCCTGCGAATCCTTCGACGGAAGCTGGACCTAGCGAAGAGACCGACCCGGCG
CAGTCATCCAGTATCACAGCGGCGAACAAGTCATCCAAGAACAAGGGGAAAGAGCGGGAGCTGACTTCGCCGGGG
CCCGGTTTCGATCTGCAAGGTGGCCCCTCGAGAAAGCGTGCTGCCTCGGAGGGGCCGGCGAGGAGACGTGCTGCT
TCGGACGGGCCTTTCCATCAACCTGGGATGAACCCTTTGGGAAGCAACAATTGGTCCTTTTCCCGCCTACCGGCT
GACGACCCTGTCGACGGCGATTCGGTTCGAACGCCTGCATCTGCCTCAGCAGCCGACGTAGAAGCATCGTCGCTA
CCAAAGGACGACGACCTGCCGGTCACCTCTACGTCGATGGACGAGGGGTCGCACCTCAACGGCACAGCCCAGGCT
CAACCCTACGACGATGATGTCAGAGAGCCGTCGCGTCATCGCGGTGCCGCGCTGGAGGAGCAAAACCCAGTCGAC
GAAGCTGCCGCTGATGGGCAAGAGGCGGCAGGTTTGGTCGGCCGCGTCGCTCATTTCATGTGGGGGGATCTCGAA
GAACCCCAAGACGGAATCGTCGAAAACGTCGCCGGCGAAGACGCCGATGCCGATGACGAGGACCCCTGGATCGAC
GTTCCGATGGCCGAGGGCGCCGACGAGAATGGCGATGTCGACTTAGGGGACGTTGACGGCGTCGTCGCTGGGGCG
GGCTTGGACGCCGAAGCACTTGATGACCTCGAGGACTTTGAGGGTGTCATGGAGCTCATCGGCATGCGCGGGCCC
ATCGCTGGCCTGTTCCAGAACGCCATCTTCTGCGCCGTCCTCGTGTCCGTCACGATCTTTGCCTGCATCTTTATT
CCTTACAACATGGGCCGCATCGCTTTCTGGGTTGTGGCAAACCCGATGCAGCTCGTCCGCATACTCTTCGAGTTT
TCCAAGGTAGTACAGGACGCCGTGATTATGCTGGGCGGCCTTAGCTCGTGGTTCGTCCTCAATCTGCTGGACATG
TTCACTGGTCTGCTCGGTGGGCCGCTGGCCGCCCAGATCGTGACGGTGAGAAAGGCATCGTGGGGGCTTTGGACC
GGGGCCGGGACGAGGGTCATGGATTACGCCCTACTGGAATTCCCCATGTCTGCCTCGGAGATGCACAACTTCTCG
GCCATCAGCCACGAGGCCCTCAACACTGTCAAAGGCTCCGTCGCGTCGGCCCTTGGGGCCCTTGGGGTTTGCCTC
GCGTCCATACTGACACCGAGCTTCTATGCGGTCGACAGGGGGTCCTTGGTTGCAGCGGCCTCGGCTATCATCACG
ACCCTCATCAACCTCAAGGCCGCTCTGTCGCTCGTCCTCGATCCAGGCTCCTGGGTCATCGACCTCAGCAGAACA
GAGGCACGTGCGGCCATCGACCCGGGCCTGGCCTACTGGTCCAGCCTCGACCGCTTCTGGGCCATCCTCGCCGGC
TACCTGACCATCTTCGCAATGGGCGCCATGTATTTGCGGAGAGGTACGCCCTTCTCGAGGAACAACATGGTGCAG
GCGTGGGAGGCCGGCATCATCGACACGCTGCACCAGGCTAGCGGCATCATGAAAGTCATCGTCATCATTAGCATC
GAGATGCTGGTCTTCCCGCTCTACTGCGGGCTTCTGCTCGACGCCGCCCTCCTGCCACTCTTTGAGAACACGACG
ATCAAATCACGAATCCTCTTCACGTACAATTTTCCCCTTACGTCAATCTTCGTCCACTGGTTTGTGGGAACTGGA
TACATGTTTCACTTTGCTCTGTTTGTGTCCATGTGCCGCAAGATTATGCGACCTGGCGTGCTATATTTCATTAGA
GATCCAGATGACCCCGAGTTCCACCCCATTCGCGATGTGTTGGAGAGGAGTCTGACGACGCAGCTGCGAAAGATT
CTCTTCTCCGCCTTTGTATACGGCGCACTCGTCATCGTCTGCCTCGGGGGTGTCGTCTGGAGTCTTTCGTACACG
TTACCCGGAGTGCTACCTATCCACTATTCGTCCAACGAGCCGGTCCTCGAATTCCCCGTCGATCTCCTCTTCTAC
AACTTTCTCATGCCCCAGGCGGTCAAAGTTCTCAAACCAGGCGACGGGCTGCATGCCATGTACACGTGGTGGTTT
CGCAAGTGCGCTCGCGGCCTGCGACTTACCTTTTTCCTCTTTGGAGAACGGCGCATTGACGAGGAGGGAACCCTT
CAACTTGGCGTCGACACGGCGGGCAGCTTTCCCCGCCACAAGAGGCTATTCCTCGAGCTCAACGAGCATAACAAG
GTCGTTCCCAAGTCCTGGCGCGACACGTTCGAGGTCGGTGATGCCAAGCCGAACCCGTCGCTGTCCAGCCGCGAG
GAGAGGCTATTGCGCCGCAAGAAGCAGCACCTAGTAGCCTCGGGCCAGCTCACGCGAAGCGGGCGATTCGTGCGA
GCCCCGGCGTCAGACCGCGTCAATATTCCCAAGGGTAAGCCGGTCTTGCTCCACGTGACGGAGCTGGGCCGGCGC
AAGGACGGCAAGCCAGACAATGACATTTACGCGTCCGGCCAGTACCAGATGGTCTACATCCCGCCAAACTTTCGC
GTCAGGATCTTCCTGTTCATCCTCTTCATCTGGCTGTTCGCGGCGGTGACAGGGGTTGGCATCACCATGGCCCCG
CTGGCGCTGGGCCGGAAGATGTTCAAGCTGCTGATTCCCGAGCACATTCGGACCAACGACATTTACGCCTTTAGC
ATCGGAATATACCTCCTGGGCACTGCAAGCTACTCTGTCCTCTGCGTCCAGAAGATCATGGCCGAGGTCCAGGCA
TGGGTTCGAAAGGCATGGATCGAGGCGACGAGAGGGCACGCTCTCAGACATGCATGGACCGGTCTCTTACGCGGC
GCCAAGTTGGTGTACGCCTACACGTTCATCCTGATCGTGTTTCCGCTCCTGTCGTCTACTCTGATGGAGCTGTAC
ATTACGATTCCGCTGCACACATACATGGATCCCCCGACGGCGGAACCGGCGCCGAAGCAGGCCGGCGAGGGAGGC
CGGCATACGATCCGCGTCATCCAGGCGTGGACCCTGGGGCTTCTGTATCTCAATCTTGGGACGAGGATGGTCAAG
TCCCTGTTCCCCGAGAGTCGAGCGGCGTTGGCGGTGCGCATCATGATGCGGAGGGGATGGTTGCGACCCGACATT
GGCATCCTGACAAGGGCGTTTGTGATGCCCGGACTGGCCTTGGCGGCAGTAGCAATGTTCGGGCCACCGCTGATG
GCGAGTTTCCTGATCGATGCGGAGGTCTTAGGCAACGAAGTCCACGGGGCGGGCGAGCTGGCGGCCATCTACCGA
CACTCGTATCCGGCGGCGGCGCTGGTGGTCGTGGTGGTCAAGCAAGCAGCCGGCATGGCCAGGGTCTTCAGGGGC
TGGAGGGCCGGAATACGCGACGAGGCCTATCTTATCGGGGAGCGGCTACACAATTTTGGCATAACGGCGGCGGGA
GGCGGTAGGGCCAAGCGGGCTTGGGGGGCGGGGAGGTCGAGGCTGTGA
Gene >Ophio5|7965
ATGTTTCTTTCAAGGTTTTAAAGTTTGCTATCCGCCCCTTTTTCCCAGTATCCACTATCTGATATACCTCAGTCA
ATACATCTTTCACGTCCTCACGGAGCCGGGTGGCTTCGCACCTCCCCGTCAAAGGGCCTCACGCTGCCAGCGTCA
ATATCTGCCTCGGTAAGTAGGGAGCCATCTTCACCCACCCATGGCTTCACACATTGGCTTCCTCTAATCCACAAA
GTTGAAATCTAGACGGCCGCACACAAAAACACTTCTCCCGACAGTCTGCCGCTTCTCTCGCCCATCTCGACTCAC
CCACCCGCCCATCTCGGAACCCACTGCCGACCGCAAATACTCACACACGACCCCTTACCCCTTCCCGTCCGACAC
GCCAATCTATCACCGTCTCTCGAATGACTTATCGCGTGGCCTGCTTGCCATAGCACCTGTTCCCGACGACTCGTT
AATCATGGCTGAAACAGCATCCGACCACAGGCCACCCGACCAAACTTCTCACCACAAACATGGCCGCTCCAGGCC
TTCTGCCCAGTCGCTCGACGCCGCGCCGTCCATCTGTCGAATATGCCGCGGTGAAGGCACAGCTGCCGAGCCGCT
CTTTTACCCTTGCAAATGCAGCGGCAGCATCAAGTACGTCCATCAGGACTGTCTGATGGAGTGGCTGTCACACTC
CCAGAAGAAGTACTGCGAGCTCTGCAAGACGTCGTTCCGCTTCACCAAGCTCTATGCGCCCGACATGCCAAAGTC
TCTGCCCTTGCACGTCTTTGTCGAGCACATGGGCAGGTACTTGTTGCGGAACCTGCTGACATGGTTGCGGGCCGC
CGTCACCATCAGCGTCTGGGCATGCTGGCTGCCCTACTTCATGCGCTCCGTCTGGTCCTTCATGTTCTGGGTCAG
TGACGAGGGCCTCGGCGGTGGCTCCTTTCTCTCTCGAGCCAACGACACCGACGCGACTACGCTGTGGCTTTCCGC
CTCTGTTGGTACATGTCCAGCCAGTCCATTGCTGGCCACAACCACCACTTCTGCAACCGAGGCGGCTGCCGTGCT
CGAGAGCCTCGACGGTGAAGACCTCTCCGAATATCTCTTGCGCATTCTATTCGGCTCGCTCGGCATGCCCATGAA
GCTTGGCCGTCCCGATCTACGACCACATTACGACATTGCCAACGCTTCTTTGGCAAATGGCGTCAGCATGCCACC
TGCGTCCCTTCTGGGCAACATGAACTTTCTCCATAACCTCACTCGAAGCCCGACGCTGAACCGGACCGTCGTTAC
GGTTCTTGAGGGACAAATCATCACTGTTTTGGTCATCATCTGCTTCATACTCGTCATCTTGGTGCGAGACTATGT
GGTCCAGCAGCAGCCTGAAATCAACATGCGAGCCGCCTTTGAGGAGCCAGGAAATGACCTTGCTCCCGAAGATCA
TGACATGGCCCAGGCCGCCGTCGCCGAGCCAGCCCAACAAGCTCAAAGGCCAGACTCCGACGACGAAGCATCGGA
TAACGTTGATAGGCCGGCGGTTGCACCGGCATCCGAAGCCGTCCCCGGAAACAACGATGCAGCCGGCGCCGCTCT
TGTCGCGCACGCCGAGCTAGCCGGTTCGCAACGAGACTCTTCCGGCCATCTCGGCACGGATCAATTCCACAATAC
CCCAACTCCGGCTGTGGCAGTCAACACTAATGGCCAGGGTAACAGCAGCGTCACGGATGCTGCGCGAGCACATCT
GCAAGACAGCGACGAATCTGATATCCAAAAAAGGATAGATTCTGTGTACGAGAAGGCTGTAGAAGAAGACTTCAA
AAAATGGGACGACACGGGGAGGCCGTCTTCGAACAACGTGGAGGAACCCGGCCGACAATCTGACTTGGCCAGACT
TGGGGATCCTGCGAATCCTTCGACGGAAGCTGGACCTAGCGAAGAGACCGACCCGGCGCAGTCATCCAGTATCAC
AGCGGCGAACAAGTCATCCAAGAACAAGGGGAAAGAGCGGGAGCTGACTTCGCCGGGGCCCGGTTTCGATCTGCA
AGGTGGCCCCTCGAGAAAGCGTGCTGCCTCGGAGGGGCCGGCGAGGAGACGTGCTGCTTCGGACGGGCCTTTCCA
TCAACCTGGGATGAACCCTTTGGGAAGCAACAATTGGTCCTTTTCCCGCCTACCGGCTGACGACCCTGTCGACGG
CGATTCGGTTCGAACGCCTGCATCTGCCTCAGCAGCCGACGTAGAAGCATCGTCGCTACCAAAGGACGACGACCT
GCCGGTCACCTCTACGTCGATGGACGAGGGGTCGCACCTCAACGGCACAGCCCAGGCTCAACCCTACGACGATGA
TGTCAGAGAGCCGTCGCGTCATCGCGGTGCCGCGCTGGAGGAGCAAAACCCAGTCGACGAAGCTGCCGCTGATGG
GCAAGAGGCGGCAGGTTTGGTCGGCCGCGTCGCTCATTTCATGTGGGGGGATCTCGAAGAACCCCAAGACGGAAT
CGTCGAAAACGTCGCCGGCGAAGACGCCGATGCCGATGACGAGGACCCCTGGATCGACGTTCCGATGGCCGAGGG
CGCCGACGAGAATGGCGATGTCGACTTAGGGGACGTTGACGGCGTCGTCGCTGGGGCGGGCTTGGACGCCGAAGC
ACTTGATGACCTCGAGGACTTTGAGGGTGTCATGGAGCTCATCGGCATGCGCGGGCCCATCGCTGGCCTGTTCCA
GAACGCCATCTTCTGCGCCGTCCTCGTGTCCGTCACGATCTTTGCCTGCATCTTTATTCCTTACAACATGGGCCG
CATCGCTTTCTGGGTTGTGGCAAACCCGATGCAGCTCGTCCGCATACTCTTCGAGTTTTCCAAGGTAGTACAGGA
CGCCGTGATTATGCTGGGCGGCCTTAGCTCGTGGTTCGTCCTCAATCTGCTGGACATGTTCACTGGTCTGCTCGG
TGGGCCGCTGGCCGCCCAGATCGTGACGGTGAGAAAGGCATCGTGGGGGCTTTGGACCGGGGCCGGGACGAGGGT
CATGGATTACGCCCTACTGGAATTCCCCATGTCTGCCTCGGAGATGCACAACTTCTCGGCCATCAGCCACGAGGC
CCTCAACACTGTCAAAGGCTCCGTCGCGTCGGCCCTTGGGGCCCTTGGGGTTTGCCTCGCGTCCATACTGACACC
GAGCTTCTATGCGGTCGACAGGGGGTCCTTGGTTGCAGCGGCCTCGGCTATCATCACGACCCTCATCAACCTCAA
GGCCGCTCTGTCGCTCGTCCTCGATCCAGGCTCCTGGGTCATCGACCTCAGCAGAACAGAGGCACGTGCGGCCAT
CGACCCGGGCCTGGCCTACTGGTCCAGCCTCGACCGCTTCTGGGCCATCCTCGCCGGCTACCTGACCATCTTCGC
AATGGGCGCCATGTATTTGCGGAGAGGTACGCCCTTCTCGAGGAACAACATGGTGCAGGCGTGGGAGGCCGGCAT
CATCGACACGCTGCACCAGGCTAGCGGCATCATGAAAGTCATCGTCATCATTAGCATCGAGATGCTGGTCTTCCC
GCTCTACTGCGGGCTTCTGCTCGACGCCGCCCTCCTGCCACTCTTTGAGAACACGACGATCAAATCACGAATCCT
CTTCACGTACAATTTTCCCCTTACGTCAATCTTCGTCCACTGGTTTGTGGGAACTGGATACATGTTTCACTTTGC
TCTGTTTGTGTCCATGTGCCGCAAGATTATGCGACCTGGCGTGCTATGTGAGGGCCAGGCCTCCGTGACTATGGA
TATAGCCATTGGCTGACGTTATCGCAGATTTCATTAGAGATCCAGATGACCCCGAGTTCCACCCCATTCGCGATG
TGTTGGAGAGGAGTCTGACGACGCAGCTGCGAAAGATTCTCTTCTCCGCCTTTGTATACGGCGCACTCGTCATCG
TCTGCCTCGGGGGTGTCGTCTGGAGTCTTTCGTACACGTTACCCGGAGTGCTACCTATCCACTATTCGTCCAACG
AGCCGGTCCTCGAATTCCCCGTCGATCTCCTCTTCTACAACTTTCTCATGCCCCAGGCGGTCAAAGTTCTCAAAC
CAGGCGACGGGCTGCATGCCATGTACACGTGGTGGTTTCGCAAGTGCGCTCGCGGCCTGCGACTTACCTTTTTCC
TCTTTGGAGAACGGCGCATTGACGAGGAGGGAACCCTTCAACTTGGCGTCGACACGGCGGGCAGCTTTCCCCGCC
ACAAGAGGCTATTCCTCGAGCTCAACGAGCATAACAAGGTCGTTCCCAAGTCCTGGCGCGACACGTTCGAGGTCG
GTGATGCCAAGCCGAACCCGTCGCTGTCCAGCCGCGAGGAGAGGCTATTGCGCCGCAAGAAGCAGCACCTAGTAG
CCTCGGGCCAGCTCACGCGAAGCGGGCGATTCGTGCGAGCCCCGGCGTCAGACCGCGTCAATATTCCCAAGGGTA
AGCCGGTCTTGCTCCACGTGACGGAGCTGGGCCGGCGCAAGGACGGCAAGCCAGACAATGACATTTACGCGTCCG
GCCAGTACCAGATGGTCTACATCCCGCCAAACTTTCGCGTCAGGATCTTCCTGTTCATCCTCTTCATCTGGCTGT
TCGCGGCGGTGACAGGGGTTGGCATCACCATGGCCCCGCTGGCGCTGGGCCGGAAGATGTTCAAGCTGCTGATTC
CCGAGCACATTCGGACCAACGACATTTACGCCTTTAGCATCGGAATATACCTCCTGGGCACTGCAAGCTACTCTG
TCCTCTGCGTCCAGAAGATCATGGCCGAGGTCCAGGCATGGGTTCGAAAGGCATGGATCGAGGCGACGAGAGGGC
ACGCTCTCAGACATGCATGGACCGGTCTCTTACGCGGCGCCAAGTTGGTGTACGCCTACACGTTCATCCTGATCG
TGTTTCCGCTCCTGTCGTCTACTCTGATGGAGCTGTACATTACGATTCCGCTGCACACATACATGGATCCCCCGA
CGGCGGAACCGGCGCCGAAGCAGGCCGGCGAGGGAGGCCGGCATACGATCCGCGTCATCCAGGCGTGGACCCTGG
GGCTTCTGTATCTCAATCTTGGGACGAGGATGGTCAAGTCCCTGTTCCCCGAGAGTCGAGCGGCGTTGGCGGTGC
GCATCATGATGCGGAGGGGATGGTTGCGACCCGACATTGGCATCCTGACAAGGGCGTTTGTGATGCCCGGACTGG
CCTTGGCGGCAGTAGCAATGTTCGGGCCACCGCTGATGGCGAGTTTCCTGATCGATGCGGAGGTCTTAGGCAACG
AAGTCCACGGGGCGGGCGAGCTGGCGGCCATCTACCGACACTCGTATCCGGCGGCGGCGCTGGTGGTCGTGGTGG
TCAAGCAAGCAGCCGGCATGGCCAGGGTCTTCAGGGGCTGGAGGGCCGGAATACGCGACGAGGCCTATCTTATCG
GGGAGCGGCTACACAATTTTGGCATAACGGCGGCGGGAGGCGGTAGGGCCAAGCGGGCTTGGGGGGCGGGGAGGT
CGAGGCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail