Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7962
Gene name
Locationscaffold_829:3103..4282
Strand-
Gene length (bp)1179
Transcript length (bp)1035
Coding sequence length (bp)1032
Protein length (aa) 344

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.5

Transmembrane Domains

Domain # Start End Length
1 49 71 22
2 136 158 22
3 185 207 22
4 227 249 22
5 288 306 18
6 321 343 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 103.25 55.93 150.58
CcL In ants, during behavior modification 75.06 39.19 110.92
CcD In ants, recently dead 114.37 62.19 166.54

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.186878 no
SC16a CcD 0.701614 no
CcL CcD 0.061851 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7962
MAPATRSSSGVLERVPEDETTPERMPDETKKADATSVGARARQDCCADGLRFLIVVAISFCMASLGYSFVGELSR
GRLAAVSRSQDSWAEIATLAAWRIFELGLSWFSGLDALDVAMLDLLAHGPLFYLQATFYSLGATTAASALLVDVL
AAATPFYLMRPLSAVHRPASRGSSFADVIDLPLQLYTSALAASIYTIIVALSLRLVLPRILVVYFPGLPSLEPAY
AASYADVLPATGLFGAAASALIYAPSATTPRDAADRKHFDPVTATLGETVRWNLWGYSSRTKIAVCRTAAAMLLV
GVNTYLSCTRTMYGVETPGAVAYAAVWVVAALCSGLALGLVGGA
Coding >Ophio5|7962
ATGGCGCCGGCGACACGGAGCTCGAGCGGGGTGCTGGAGCGAGTGCCGGAAGACGAGACGACGCCGGAACGGATG
CCAGACGAGACCAAGAAGGCGGACGCGACGTCGGTCGGGGCTCGGGCGCGGCAAGATTGCTGCGCTGATGGCTTG
CGCTTCCTCATCGTCGTCGCCATCAGCTTCTGTATGGCGAGTCTGGGATACAGCTTCGTGGGCGAACTGAGCCGG
GGACGGTTGGCGGCCGTGAGCCGGAGCCAGGACTCGTGGGCTGAGATTGCTACCCTGGCGGCCTGGAGAATCTTC
GAGTTGGGACTGTCTTGGTTCAGCGGTCTGGATGCCCTGGATGTGGCCATGCTCGATCTTCTGGCACACGGTCCT
CTGTTCTATCTTCAGGCTACCTTTTACTCGCTCGGCGCCACCACAGCGGCGTCTGCGCTGCTCGTCGATGTGCTG
GCCGCCGCCACACCTTTCTATCTCATGCGCCCACTTTCGGCCGTCCACCGGCCCGCGTCTCGTGGCAGCTCCTTC
GCCGACGTCATCGATCTGCCGCTGCAACTGTACACGTCTGCGCTGGCAGCGAGCATCTACACCATCATCGTCGCC
CTCTCGCTGCGACTCGTCCTACCGCGCATCCTCGTCGTCTACTTCCCCGGCTTGCCCAGCCTCGAGCCAGCCTAC
GCGGCATCGTACGCCGACGTGCTTCCCGCGACAGGCCTTTTCGGCGCCGCGGCCAGTGCCTTGATCTACGCGCCC
TCGGCTACTACGCCCCGTGACGCGGCTGACCGAAAACACTTCGATCCGGTGACGGCTACGCTGGGCGAGACGGTG
CGGTGGAACCTGTGGGGTTACTCGTCTCGCACAAAGATTGCTGTCTGTCGCACGGCAGCAGCGATGCTCCTCGTT
GGCGTCAACACATACCTCTCCTGCACCAGGACCATGTATGGCGTCGAGACGCCTGGTGCCGTCGCTTACGCCGCC
GTCTGGGTCGTGGCCGCGTTGTGCTCGGGGCTGGCGCTCGGCTTGGTCGGTGGCGCT
Transcript >Ophio5|7962
ATGGCGCCGGCGACACGGAGCTCGAGCGGGGTGCTGGAGCGAGTGCCGGAAGACGAGACGACGCCGGAACGGATG
CCAGACGAGACCAAGAAGGCGGACGCGACGTCGGTCGGGGCTCGGGCGCGGCAAGATTGCTGCGCTGATGGCTTG
CGCTTCCTCATCGTCGTCGCCATCAGCTTCTGTATGGCGAGTCTGGGATACAGCTTCGTGGGCGAACTGAGCCGG
GGACGGTTGGCGGCCGTGAGCCGGAGCCAGGACTCGTGGGCTGAGATTGCTACCCTGGCGGCCTGGAGAATCTTC
GAGTTGGGACTGTCTTGGTTCAGCGGTCTGGATGCCCTGGATGTGGCCATGCTCGATCTTCTGGCACACGGTCCT
CTGTTCTATCTTCAGGCTACCTTTTACTCGCTCGGCGCCACCACAGCGGCGTCTGCGCTGCTCGTCGATGTGCTG
GCCGCCGCCACACCTTTCTATCTCATGCGCCCACTTTCGGCCGTCCACCGGCCCGCGTCTCGTGGCAGCTCCTTC
GCCGACGTCATCGATCTGCCGCTGCAACTGTACACGTCTGCGCTGGCAGCGAGCATCTACACCATCATCGTCGCC
CTCTCGCTGCGACTCGTCCTACCGCGCATCCTCGTCGTCTACTTCCCCGGCTTGCCCAGCCTCGAGCCAGCCTAC
GCGGCATCGTACGCCGACGTGCTTCCCGCGACAGGCCTTTTCGGCGCCGCGGCCAGTGCCTTGATCTACGCGCCC
TCGGCTACTACGCCCCGTGACGCGGCTGACCGAAAACACTTCGATCCGGTGACGGCTACGCTGGGCGAGACGGTG
CGGTGGAACCTGTGGGGTTACTCGTCTCGCACAAAGATTGCTGTCTGTCGCACGGCAGCAGCGATGCTCCTCGTT
GGCGTCAACACATACCTCTCCTGCACCAGGACCATGTATGGCGTCGAGACGCCTGGTGCCGTCGCTTACGCCGCC
GTCTGGGTCGTGGCCGCGTTGTGCTCGGGGCTGGCGCTCGGCTTGGTCGGTGGCGCTTAG
Gene >Ophio5|7962
ATGGCGCCGGCGACACGGAGCTCGAGCGGGGTGCTGGAGCGAGTGCCGGAAGACGAGACGACGCCGGAACGGATG
CCAGACGAGACCAAGAAGGCGGACGCGACGTCGGTCGGGGCTCGGGCGCGGCAAGATTGCTGCGCTGATGGCTTG
CGCTTCCTCATCGTCGTCGCCATCAGCTTCTGTATGGCGAGTCTGGGATACAGCTTCGTGGGCGAACTGAGCCGG
GGACGGTTGGCGGCCGTGAGCCGGAGCCAGGACTCGTGGGCTGAGATTGCTACCCTGGCGGCCTGGAGAATGTGA
GTTTCCCGACATGCCAAGGGTCCACAAACGTCCGGCGGTCAGGCTGACTGACGCCCGCTTCTCCCCCGGCCGGTA
GCTTCGAGTTGGGACTGTCTTGGTTCAGCGGTCTGGATGCCCTGGATGTGGCCATGCTCGATCTTCTGGCACACG
GTCCTCTGGTAAGTGCAGGAGCCCTCGGTTCCCTTGGCTTGTCGACGTGACGTTGACGAGGATGCGGTCCAGTTC
TATCTTCAGGCTACCTTTTACTCGCTCGGCGCCACCACAGCGGCGTCTGCGCTGCTCGTCGATGTGCTGGCCGCC
GCCACACCTTTCTATCTCATGCGCCCACTTTCGGCCGTCCACCGGCCCGCGTCTCGTGGCAGCTCCTTCGCCGAC
GTCATCGATCTGCCGCTGCAACTGTACACGTCTGCGCTGGCAGCGAGCATCTACACCATCATCGTCGCCCTCTCG
CTGCGACTCGTCCTACCGCGCATCCTCGTCGTCTACTTCCCCGGCTTGCCCAGCCTCGAGCCAGCCTACGCGGCA
TCGTACGCCGACGTGCTTCCCGCGACAGGCCTTTTCGGCGCCGCGGCCAGTGCCTTGATCTACGCGCCCTCGGCT
ACTACGCCCCGTGACGCGGCTGACCGAAAACACTTCGATCCGGTGACGGCTACGCTGGGCGAGACGGTGCGGTGG
AACCTGTGGGGTTACTCGTCTCGCACAAAGATTGCTGTCTGTCGCACGGCAGCAGCGATGCTCCTCGTTGGCGTC
AACACATACCTCTCCTGCACCAGGACCATGTATGGCGTCGAGACGCCTGGTGCCGTCGCTTACGCCGCCGTCTGG
GTCGTGGCCGCGTTGTGCTCGGGGCTGGCGCTCGGCTTGGTCGGTGGCGCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail